SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM567460-PA|EEB19322.1|hypothetical from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  vb|PHUM567460-PA|EEB19322.1|hypothetical
Domain Number - Region: 421-490
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.051
Family BCR-homology GTPase activation domain (BH-domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM567460-PA|EEB19322.1|hypothetical
Sequence length 552
Comment protein Phum_PHUM567460|DS235864.1:24751:27715:1|gene:PHUM567460
Sequence
MQNRESVTSVVKFTRNKDDKKTYRSLSAELTKVFSLEEIKAEVQWWKVFKNYIRGRSGVL
GRTYYFEKMCGLCLANPKEQKWLIKFRNVGLRRLNVFIINATKKEALSKDIKLLTWCSLS
LLHFFYSKTQNRIDDCSCFRMSKLEQAKDLFRNTMYLILPEKQNEVVKQTIRYMTMTGQW
NSQDYDLFVFQELLTMITKTEFLIAKVIKQTETSQKEMKIKEAFDVSCTLSTLLEQTFWD
RYLYNHLLHNCYNTLLKLFILGSNPVPSSFTLENAKFKVVIKTCIRNFISNIKDNKGLVS
VMDSMAKCLQDDTIGYEDKVEITEIIAYTAQKHSCKYYRESMTADLLDFLLINLNLPDKG
LIMLAHKIFHLFLDRHSNLRFFAEPVYFFKGRSDFVINYDFNVEDAQFFKNFSADFFRSI
HKNMLLFYNKYELVTYYSTLCIVLIEIPDPVITINILHLIITAQNDVIKLSNEIPMTSKA
HIHAIIASLISLICVIHKEEVRALEKNVEEVNKYSVAGHHTTEYHDQLYFLEEEILYALQ
RCWLTRRMTTYR
Download sequence
Identical sequences E0W116
vb|PHUM567460-PA|EEB19322.1|hypothetical XP_002432060.1.24195 121224.XP_002432060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]