SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM567500-PA|EEB19326.1|guanine from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM567500-PA|EEB19326.1|guanine
Domain Number 1 Region: 47-250
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.03e-52
Family DBL homology domain (DH-domain) 0.00016
Further Details:      
 
Domain Number 2 Region: 249-364
Classification Level Classification E-value
Superfamily PH domain-like 9.25e-18
Family Pleckstrin-homology domain (PH domain) 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM567500-PA|EEB19326.1|guanine
Sequence length 418
Comment nucleotide exchange factor, putative|DS235864.1:48141:49780:1|gene:PHUM567500
Sequence
MNNTLLQSTPLTFSEELKKAFNERNILTTRSKMKVLSALNEFTKTSKIQKEKELKEKAIN
EIYTSEINYLKQLEIIMKYFMEPLRNKNWLPTNTFHALFGNIEILYKVNGELLQELKKQN
GNVGAAFNRLAPYLKLYSVYAYDYKQALQILQEMQKNNKELHEFITTHEKRPEVSASFQS
LLIVPIQRIPRYKLLLQEVLNHTCVDDPEYFILQGALKKIEETASHINDHVSQYENVESM
LSLAKRLTGSPLDIVEPGRKIIKQGSLMKVSKNWKRSDSRYVILFSDYLMYCKGSEMGPL
KFSGLLPIRHCQVEPIFSTGVFKIVCQEEVLFFYTSDSKYGSEWINSLQTATKEHQECRK
TLRKESSRRKPLRRSNNNNNNSNKYNNYGSKNYKFFNRKEQQTTTNYSGCFGRLLFLR
Download sequence
Identical sequences E0W120
vb|PHUM567500-PA|EEB19326.1|guanine XP_002432064.1.24195 121224.XP_002432064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]