SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM568450-PA|EEB19332.1|guanine from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM568450-PA|EEB19332.1|guanine
Domain Number 1 Region: 559-778
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-52
Family DBL homology domain (DH-domain) 0.00024
Further Details:      
 
Domain Number 2 Region: 929-993
Classification Level Classification E-value
Superfamily SH3-domain 6.83e-20
Family SH3-domain 0.00096
Further Details:      
 
Domain Number 3 Region: 769-914
Classification Level Classification E-value
Superfamily PH domain-like 0.00000812
Family Pleckstrin-homology domain (PH domain) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM568450-PA|EEB19332.1|guanine
Sequence length 1020
Comment nucleotide exchange factor, putative|DS235865.1:37984:42350:1|gene:PHUM568450
Sequence
MKLGNSEGSLFYEEASNPSICSQSSRESTFRKRPHIGDIIFISSHSIIYLGDIENKLISL
HAAKNYTDDDGDKLKIVFSIPRPALRKKHKPSPTIRVLLYKTDKRECQENTLFLEEEIKL
QDSEDHFYESVGHYENAEIIQENARSSQGGIQDNNYVDKDHYNNNDEQFIDDFDSQSSED
EAYVDTKLPDIPNQGYNITKSLRAAGKKLRKNFSLRKSDLSKSLKRFKKSSRGKVVDLTT
ESSNPNLGIGKEVEVEAGNQKPSESPSTPPNLSNSIYSNNSDSSSSSHNVNKSINNAIES
KNQRHRKSWTFRSKFKNSSNDVSDANGGIDANRNSTFYLSLNEVKPKKVVEKKNDLLNEI
QSAISKRNSNSSESVTDKDIMRHSDSVSTLTKFRPTVPPPPPPSSKPDSVAPEKTKYSDI
LWGEKATNNCLYVESGLFDKQKKHSRCSDSDTSLYAEIGLYAANDELNSRKTQMFVDEPL
YQFYTECVNQRARDDILNNYDSEGYEEINDYYSVINEKRRTIDIKNVRPNFEDFNEDVNT
KISSLRSISDRRTLWCQIPAVIDSCILQTLSDQARKLQEAKFEIITSEGSYMNSLNVLEN
HFMKKVNDLNIITKRDFRILFSNIVSVKKCSESFLEDLENCWQNNIMLNGICDIVYKHST
TSFQVYTKYCKNQVCIYRTLRELLDKNWNFENALKEIESDPICQNLNIHSFLMLPMQRIT
RLPLLMGAVLARMDKDDDEFEVCKASFDVLNKIVQDCDDEARRMEKCEEMLILSQQIEFP
KDIRRIPIITGSRFLVKSGQVTQLVNRDENKLTFGKKFSKITLTLFLFTDLLIVAKKKNP
RNYVVVDHCPRNLVQMQTTDGLTQLPVKLNSNSDSSGKLLMLLTMLENHEKKTVEMILSF
EMESDKQRWLEAVTPKSSENPNECIYEEWDCPQVIALYEFTPVQPDELNLCIGDVVNVLK
KMSDGWYQGERLRDGARGWFPQNHTQEVSSSHIRAKNKKLRYKLLALSGNLIDSQKMNGK
Download sequence
Identical sequences E0W126
121224.XP_002432070 XP_002432070.1.24195 vb|PHUM568450-PA|EEB19332.1|guanine

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]