SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM569730-PA|EEB19361.1|hypothetical from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  vb|PHUM569730-PA|EEB19361.1|hypothetical
Domain Number - Region: 23-73
Classification Level Classification E-value
Superfamily PH domain-like 0.000646
Family Pleckstrin-homology domain (PH domain) 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM569730-PA|EEB19361.1|hypothetical
Sequence length 88
Comment protein Phum_PHUM569730|DS235866.1:349362:349988:1|gene:PHUM569730
Sequence
MHIWLWFAVTIIIVVLTIENGEIVAKEDEVPLFVHHASNVSKFCLEPGNMRTFMYLVRDK
FEPVLNVYLFQSDCCEDVSALNFIYLFI
Download sequence
Identical sequences E0W155
XP_002432099.1.24195 121224.XP_002432099 vb|PHUM569730-PA|EEB19361.1|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]