SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM573900-PA|EEB19417.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM573900-PA|EEB19417.1|conserved
Domain Number 1 Region: 68-387
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.05e-78
Family Protein kinases, catalytic subunit 0.00000538
Further Details:      
 
Domain Number 2 Region: 1309-1374
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000124
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.024
Further Details:      
 
Domain Number 3 Region: 1408-1522
Classification Level Classification E-value
Superfamily PH domain-like 0.000077
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Weak hits

Sequence:  vb|PHUM573900-PA|EEB19417.1|conserved
Domain Number - Region: 732-913
Classification Level Classification E-value
Superfamily Tropomyosin 0.000108
Family Tropomyosin 0.0016
Further Details:      
 
Domain Number - Region: 1045-1243
Classification Level Classification E-value
Superfamily Tropomyosin 0.000785
Family Tropomyosin 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM573900-PA|EEB19417.1|conserved
Sequence length 1961
Comment hypothetical protein|DS235867.1:272766:281835:1|gene:PHUM573900
Sequence
MNTSKEPISLRNGRLFNSVLTRSGPMQRTTRMRMSQDALLDAFILLYDECTKDTLRKDMY
MTNFINKYRSLLTEVKTLRVNLNDFELKSIIGQGHFGEVRVVREKQTNDIYAMKIIKKFE
MPGKICSVLFEEERDIMCTATSHWLTTLQYSFQDNENLYYIMEYHSGGDLLSLLDRHEGI
LTPEMAKFYLAETALAIRALHQMGYVHRDIKPDNILLDRCGHVKLADFGSAAKLNSGGLV
TQMMPVGTPEYIAPEILLSLGHGYEDKIKKQYYGMECDYWSLGILAYELVVGRTPFSGSQ
IKATYFNIMNHKKKFKYPEDRSIPESLQDLISKLLEDSSIRLKHDGIVKHPFFHDTNWNN
IRNEVPPFVPSSNSPDDVSNFIDIVRKKSAPKIEMKNCRMNFSGKQLPFIGFTFSHVPDI
CEKKLTDSEDINYKEKKGPNFESMFSKKENKNVVSKLIESQFGKNEELENMEKKFEEKKR
LLEICEKDRNKLQRELAKCLAEKNNIQKILEMEREDRREMEANALKLISETKIKIEKNFG
NQIKQLNAEIEEVNDKLTEAHTINNELINNLDRVKSDLHTANKEIERLKNLETEFKNKMA
EAREFKRKSVVGIETRLEKMAQDNQLQSSILQQKLSDEVAIKTKLEQKLKEIECSWASQE
SKLKQEIADNEEKIKKLELKIKSQQSEIATFEIKLSEKSNIAILEEKLLLERNECIKLRD
QIIELNNSTCSLSEHKSILAAHEETMKALEKELREASEEKIKLQRKLQKTKEVEDENRQK
LSHLEVVVDRLEQGVIKLEAENAQLKKDVIAHAQPLTSEAETRYREKITLLEDQIAKLEN
QVQKLRESSVLDKESLRTTQAALWKTEKELSDAKIDIRIAKREAKTAEDTVTRLQEEIKN
LTEKLSAAEEKSQKSVSAEREKLDKLILEKNHVKVELSQRDSEIKMLKNQLEELEELKKI
EKQLKRDLIEATQKCKMLEKEIDKLQNEKEKEKINYESIDKKKSEMEKTIEELKQKISSL
EVNNAVLKETGAMLDEQLEDYDKFTSSQAEKIEKLTEEKSSLEKNLEKIQNELRVCRQNL
NEEKSFKIRAEQKVAFLESEIESKKDSITQLQKDIHNCNVTIENLKSQLNEYENKCLTYE
MELKEGRQMYDALENECQWMKKEASTYLTNLYSLRESNYKLTQDLEEEHTMVERLQERIT
ELQSVVTELEHFHKQREVKDEATKQQQNKLIAFLQEKLDDTKKKKSLTDVLFGTRNKENL
IPFNSPPSNKNVANVLMKNKSPRNLLNSPSTKEALNQIVKSPTSQSYFQRQASLQRMHHN
IPHRFKSQTKIKSGTCNVCNLQLSRNGQCSICTQCKFVTHTKCAMIAPKTCGLPQGLVKH
YAKSVVKTNSDDVTFKMENANCQSLEKLEGWIKILNTTKTNWEKKYAKLEENKVLIFDEK
PVDSTVVPLNSFNLCPDNGQVIVGESVDPKELPNTASANLPFIIKIACVPETTCWPEQIN
YLMILSSSDKTKWLSALNSAVINSKVDENRKYAGSVVYSFPKDSILNVNCVIQISEKLSL
LGTEEGLFSFKLSTPNAQPVKIEGISKVFQMALAPQIGVDLMIVEKERRLVMCDHRALIS
NAEAAACSNPSISVRPIEKNLEKESCIMFAISPPNADKEVFVTVATHNKLFILKWCYKTS
EFYKAKVLETLHPCNCVLYLKHSVIVGCDKFFKIDLNDFSATEFLDPSVKSLAFWKIGSF
PMEIFRISKSEFLLCFNEFGVFVDEEGRKTQCDLKWSKVPCDFAYSKPYLFVIHLASVEV
IRVPFLDSKSSDDSICTSSTATINDSAQINLSSPQYLGESKSPCSIFVKANSSTHVNLLL
IEGNKLYKNDLGSCMSLNTKINILALVIASCFSSLAEHQVRDNKNDGDEFSFTSSIVHSL
ENVGTSTPRDSDEESCSTYTVSENDNLNNRKVVTFEQKSVL
Download sequence
Identical sequences E0W1B1
XP_002432155.1.24195 121224.XP_002432155 vb|PHUM573900-PA|EEB19417.1|conserved

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]