SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM574140-PA|EEB19421.1|Talin-2 from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM574140-PA|EEB19421.1|Talin-2
Domain Number 1 Region: 505-668
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 5.75e-64
Family A middle domain of Talin 1 0.00000953
Further Details:      
 
Domain Number 2 Region: 2316-2506
Classification Level Classification E-value
Superfamily I/LWEQ domain 7.59e-54
Family I/LWEQ domain 0.00016
Further Details:      
 
Domain Number 3 Region: 674-798
Classification Level Classification E-value
Superfamily I/LWEQ domain 5.89e-49
Family I/LWEQ domain 0.0000191
Further Details:      
 
Domain Number 4 Region: 768-904
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.14e-47
Family I/LWEQ domain 0.0000365
Further Details:      
 
Domain Number 5 Region: 1241-1377
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 4.08e-33
Family VBS domain 0.088
Further Details:      
 
Domain Number 6 Region: 1867-1993
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 9.1e-31
Family VBS domain 0.00016
Further Details:      
 
Domain Number 7 Region: 201-315
Classification Level Classification E-value
Superfamily Second domain of FERM 6.41e-30
Family Second domain of FERM 0.0000111
Further Details:      
 
Domain Number 8 Region: 316-406
Classification Level Classification E-value
Superfamily PH domain-like 1.62e-24
Family Third domain of FERM 0.0000385
Further Details:      
 
Domain Number 9 Region: 1093-1224
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000000000000173
Family alpha-catenin/vinculin 0.032
Further Details:      
 
Domain Number 10 Region: 1476-1570
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00000000000285
Family I/LWEQ domain 0.0084
Further Details:      
 
Domain Number 11 Region: 2029-2153
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000000439
Family VBS domain 0.017
Further Details:      
 
Domain Number 12 Region: 1601-1675
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000267
Family VBS domain 0.028
Further Details:      
 
Weak hits

Sequence:  vb|PHUM574140-PA|EEB19421.1|Talin-2
Domain Number - Region: 1703-1821
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00033
Family alpha-catenin/vinculin 0.033
Further Details:      
 
Domain Number - Region: 82-138
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00033
Family Ubiquitin-related 0.082
Further Details:      
 
Domain Number - Region: 936-998
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00235
Family I/LWEQ domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM574140-PA|EEB19421.1|Talin-2
Sequence length 2573
Comment putative|DS235867.1:299553:313355:-1|gene:PHUM574140
Sequence
MAALSLKICIVDQNFSKTMNFNPSTSVYDACKFIREKISEAHLGEPKDYGLFLADEDQKK
GVWLEPGRNLDYYILRNGDLLEYKRKLRTLRVRMLDGTLKTLLVDDSQPVANLMVVICTK
IGITNHDEYSLVRENLEDELENKPNFGTLTLKRKKEEKEKDAKMEQLRKKLKTDDEVNWI
DPSKTLREQGIDESETVLLRRKFFFSDQNIDSRDPVQLNLLYVQARDAILHGKHPVTQEK
ACEFAGIQSQIQFGDHIESKHRPGFLDLKEFLPLSYLKVKGIEKKIFSEHKKHQGLSELD
AKVLYTKTARALKTYGVAFFLVKEKIKGKNKLAPRLLGVTKDSVLRLDEKTKEILQTWPL
TTVKRWGASPNTFTLDFGDYSDEYYCVQTTEAEQIQQLIAGYIDIILKKKQSKDHFGIEG
DEGSTMVEDSVSPLKATILQHETNKIGKVNTESVAKPAIMRAGADGARTYGTGHMGAAQY
STVSGQLHLAHAPPTMQQTKITNVLSEPHRALLSTISAGHEVIVTAEKELVTKVPIPPLG
TDPASVKWKEDTLDTNKQNVSSQIAAMNAATAQVVTLTSGNEDVDHTAVGAAITTIASNL
PEMTRGVRMIAALMEDSGNGEKLLEAARQLCHAFSDLLKAAEPEAKETRQNLLSAASRVG
EASHQVLTTIGEDSEDNKELQDMLLDLAKAVANTTAALVLKAKNIASTCDDPNVQNKVIS
AASQCALATSQLVACSKVVAPTLSSPACQQQLMVAVKEVAKAVEDLVKVCNSATTDDNLL
RELSQAAAEVTRTLNELLNHIKGYSREKAKETVQESAVETILISTDRLLASSADSTEMVR
QARVLGQATAQLIQAIKGEAEKQPDSEIQRRLLAAAKVLADATAKMVEAARLCASNPNDV
YRQNSLRRAVEDLRLATTQAATPALRRKLFSRLENAAKQAASSSIQCLTAAQNAGQSNQS
KASQDELLTDCRSLADALPRLAEGVKGSVANPESSSAQLNLINASEQFLQPGARVVQSAL
SVVPTVSDQASALQLSNSSQQLATSLNDLRSAVDKAKEVCGGYDGEAFNSASQLIRSLKT
ELDAFYKAAMRNELHPLPGETAADAALNLGTASKNVRSAMSQLQTAAAQQNDNYTGLAAQ
ETASSLKDLTMAVRGVASTTKDRQLQTKVIQSADNVMNKSLTLIEEAKATLISGEEANNR
ELMSISKDVSAALNQCVSCLPGQKDVDEVIDNIHDAAQVLTMNEFPHTNKSYGELQQELN
SAAVNLNDASTEVVTSVRSSSKLAESSKTFGNAFNDLMGVSMEMAGQTKDTDIRSQMVVS
LKNVSLVSSKLLTTAKTVASNPSAPNAKNQLTSAARAVTDSINYLVDVCVSAAPGQKECD
NAIRNIQSMRPLLDNTNEPVNDCTYFECLDTVMAKSKSLGDGMTGIANHAKKSEYEQFGE
AVKGVSSSICGLIEAAAQSAYLIGVSDPSSTAARPGLLDQAQLARASQAIQTACQDLSNP
TSNHEQVLSAAAVIAKHTSGLCNAFRLASTKTTNPVAKRHFVQSAKEVANSTANLVKEIK
NLDQDYSEINRQNTSRATKPLLEAVDNLCTFASSSEFASSPAKISAAARSAQEPITSAGH
AIIDGSCSMVTAAKSLAVSPRDPPTWQLLANHSKSVSDSIKKLVSSIRNKAPGQKECDDA
IEILTGLMRELDEATLAGVRQSLQPHRENTLQGFTDQVQTSVNEISEKLNPLKIAAKSQA
ENVGHTVTQFIQYFVPLVKNSIGAASNIIHSQQQMLLLEQTKTLTESAIQLICAAKEGGG
NPKALNIHPDIDESTEATREALRDLNLTLEHLSTQAGVITGLLDSITRAMTRVTDNRSST
IDIDQIDSFVDYQTRMVSRCKEIAHIAQEMATKSSSDTDKLGKLSADLAKNYSQLATDSI
GAASSTSNADVSTRIRSGIQTLGKSCTDLIKAGNNRQIAPMGDTFAQRDVTEASRHVSER
VSQILAALQAGSRGTQACINAASTVSGIIGDLDTTIMFATAGTLHAENENETFADHRENI
LKTAKALVEDTKTLVAGAASSQEQLAVAAQNAVTTIVQLAEVVKFGAASLGSNNPEAQVM
LINAVKDVASALGDLIQATKAASGKGIDHPSMNHLKDSAKVMVTNVTSLLKTVKAVEDEH
TRGTRALEATIEAIAQEIRALQSPDQFKSTATPEDLVRCTKPITTATARAVAAGNSGKQD
DAIVAANVGRKAISDMLSICKGVASNAETVEARNRTLQAGHDVAVQYRELLQAILHVLSK
PGSAEAKNLLPTISRKIAQCVTELVTSAQLLKGADWVDPDDPTVIAENELLGAANSIDAA
AKKLASLRPRRSIQETDESLNFDEMILEAAKSIAAATSALVKAASAAQRELIDLGKVSRR
PLTSSDDGQWSEGLISAARLVAAATHSLVESANSLVQGVSSEEKLISAAKQVASSTAQLL
VACKVKADPDSDSTKRLQAAGNAVKRATDNLVRAAQQAIQQEEERSLILNKRMVGGIAQE
INARSEVFRIERQLEEARSRLTAIRQAKYKLKGGDSDVETDGYQSGYESYGNR
Download sequence
Identical sequences E0W1B5
121224.XP_002432159 vb|PHUM574140-PA|EEB19421.1|Talin-2 XP_002432159.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]