SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM584020-PA|EEB19698.1|Cytoplasmic from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM584020-PA|EEB19698.1|Cytoplasmic
Domain Number 1 Region: 313-414
Classification Level Classification E-value
Superfamily SH2 domain 7e-27
Family SH2 domain 0.0004
Further Details:      
 
Domain Number 2 Region: 148-208
Classification Level Classification E-value
Superfamily SH3-domain 4.33e-23
Family SH3-domain 0.00092
Further Details:      
 
Domain Number 3 Region: 218-296
Classification Level Classification E-value
Superfamily SH3-domain 1.3e-19
Family SH3-domain 0.00023
Further Details:      
 
Domain Number 4 Region: 42-108
Classification Level Classification E-value
Superfamily SH3-domain 3.81e-19
Family SH3-domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM584020-PA|EEB19698.1|Cytoplasmic
Sequence length 424
Comment protein NCK1, putative|DS235874.1:117158:118975:-1|gene:PHUM584020
Sequence
MLEACSCQSPGNVTWQGKINSYSSPSHHIGIMRPHGKGNQDDVCYVVAKYDYAAQGAQEL
ELRKNERYMLLDDSKHWWRVQNSRNQSGYVPSNYVKKEKPSLFDRHVHIKKKVKKGSGSK
TLPPNSNNSPSRTMDSPSLSRKLPADPSEAIGTAVVKYNYQAQQPDELSLTKGTRILILE
KSNDGWWRGQSGGASGWFPSNYTQEEGDGDDGIHTYAMAENVLDIVVALYSFSSNNDQEL
SFEKGDRLEILDRPPADPEWYKARNAQGQIGLVPRNYLQELSEYLTQPFRDRGVGGNAER
HDSMDRRPPDGMDRPHLIGKPWYYGNITRAHCDSVLNQHGHDGDFLIRDSETNVGDYSVS
LKAPGRNKHFRVYVEGALYCIGQRKFHTLDQLVDHYQRAPIYTNKQGEKLYLVRPLPKPG
GPQV
Download sequence
Identical sequences E0W242
vb|PHUM584020-PA|EEB19698.1|Cytoplasmic XP_002432436.1.24195 121224.XP_002432436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]