SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM584690-PA|EEB19713.1|protein from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM584690-PA|EEB19713.1|protein
Domain Number 1 Region: 272-561
Classification Level Classification E-value
Superfamily BEACH domain 1.26e-113
Family BEACH domain 0.000000085
Further Details:      
 
Domain Number 2 Region: 586-878
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.06e-54
Family WD40-repeat 0.0044
Further Details:      
 
Domain Number 3 Region: 173-271
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000799
Family PreBEACH PH-like domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM584690-PA|EEB19713.1|protein
Sequence length 889
Comment FAN, putative|DS235874.1:265937:270697:1|gene:PHUM584690
Sequence
MEKTRFSLLLLEPGEIYFEDYSASLFPNQVNRENFETSRQLGRIKLCSKSLVFDPQDFNK
PIIKIPLQNCIGIKRGKRPWASEEDNVIQIECSNYVEMLEENVIAAYKFKQEKTLFLFLL
NYAKVDDCLSHILQLYRASTLPPHEQSSMIAAIVYSRQSRVSFDAKWLEDIYEKVICETQ
ANKISPLVVNPGRIVLTCSRIYFQPYNNIESHSVLKIDLKNITRIICRRFLLKQVGIEIF
YKCCSKSETSHFYVAMKSKEVRDKFYESILQQPNLTLTSVEPEIITLKWQNRAISNYEYL
LYLNSLADRSFNDLTQYPVFPWVLSNYISKTLDLKDSKSYRDLTKPIGALNEERLERLKE
RTLEMPEPKFLYGSHYSAPGFVIFYLVRKYPHYMLCLQNGRFDHPDRMFNSIADVWRNVI
NNMSDFKELIPEFYDVSQSGDFLLNTYGINFGYRCNGSKVHDVSLPPWAENPADFVSKLR
EALESEYVSSNIHHWIDLIFGYKQRGEEAKKANNIYYYLCYEGAVDIDLVKDYNERHALE
VQIMEFGQVPKQIFKVPHPPRLPLLNPQSRIGNSVLEETSSENTEKPIKDAILNLSRSTI
IGYHKDVVTSVAISSNNKFILSSSKDSTIRMFAAETEKQIRSFNLNNVGISCCILLPDDN
LIVAGTYDDQILVYDIMFNKLIDSIIAHEDTVTSICWGSVSRCLVSSSRDCTLKIWFNIY
QDDKWHRLKITSALRFDLDSRITCSVINGDNSLIGSGTEDGEIIVIDVTNKNKVFKRTAH
NGPVHGISFSPENGKLVSCGWDGCFKVYDLLTGMEVYSKSLKAQLTCLAWNGLSLLLGSN
SGIVFLWDLVEVKLIKEIECKGNNIHCITVSQNGKFLIQKCIFRSYRNR
Download sequence
Identical sequences E0W257
XP_002432451.1.24195 121224.XP_002432451 vb|PHUM584690-PA|EEB19713.1|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]