SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM584760-PA|EEB19720.1|serine/threonine-protein from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM584760-PA|EEB19720.1|serine/threonine-protein
Domain Number 1 Region: 72-417
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.77e-81
Family Protein kinases, catalytic subunit 0.00000214
Further Details:      
 
Domain Number 2 Region: 1029-1085
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000269
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0024
Further Details:      
 
Domain Number 3 Region: 1101-1222
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000448
Family Pleckstrin-homology domain (PH domain) 0.052
Further Details:      
 
Weak hits

Sequence:  vb|PHUM584760-PA|EEB19720.1|serine/threonine-protein
Domain Number - Region: 1255-1323,1419-1534
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.00131
Family Tricorn protease domain 2 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM584760-PA|EEB19720.1|serine/threonine-protein
Sequence length 1772
Comment kinase MRCK beta, putative|DS235874.1:300133:310364:1|gene:PHUM584760
Sequence
MSETLEKLASETGSHGTTGEKRLQQLEALFLGGPIQGQGQCFSLETCLDILLVLYDECCN
SSLRREKAVSDFIEFVKPVASCVKNLRLARDDFEIIKVIGRGAFGEVCVVKMKGSDKVFA
MKILNKWEMLKRAETACFKEERDVLVYGDRRWITNLHYAFQDDNNLYLVMDYYCGGDLLT
LLSKFEDRLPEDMARFYIAEMILAVSSIHELRYVHRDIKPDNVLLDANGHIRLADFGSCL
KFLEDGTVQSNVTVGTPDYISPEILRAMEDGQGRYGPECDWWSLGVCMYEMLYGETPFYA
ESLIETYGKIMNHKNCFDFPQDVGYEVTPEAKDLIKKLICSAEFRLGQNGVQDFKNHAWF
DGLDWDSIRDSSAPYVPEVSSPTDTSNFDVDDTDIRTSDAVPPAANPTFSALHLPFVGFT
FTQGSRISDLSSIPIGSVQQNSGLVEKRVKKLEEEKQLLLKSLSESKILKVSNSNSSDVG
TDKMNLANSTRILQEEINTLTKNNNDLKAQIQLLEQKTSDTKYLVNDSEADEKIKELEKN
IKLLNQEKDSMQKDKLDAEEKLKFQDKELKDALSQRKLAMAEYNEVTDRLSELRQQKQKL
SRQVRDKEEELEVAMQKIDFLRHDIRGAEKLRRELEGRIEEAIAEAGKERKLRERSEEYC
KQVEEETEKMRQRLVAGDNTSAQAHATQEISRLKAEVEKLKVQYNENLSQQQSRYTVEIS
SLRDQLQEERNRREMLDREIHLAKEKLETSRLENLTDSEETISELTRRHEREKMILLEDN
KKLMMDLEMLSDSVDRIQSERRQIEEEYEELRNKKDAIVQWEAQITEIIQWVSDEKDARG
YLQALTTKMTEELEFLKHSKSSNVNSSDAKNWRNRRSQKLDKMELLNLQSSLQSEIQAKQ
VISEELTKTRTELIAAQKELRDFHANFESLSHEIKRKELQIKELQSRLDSGEGFLERPPS
QMSYLDHFLKESSMRHGGSVESEEGDVEDNRAPSFTSSKSNLSELSIDPGSPLEIRRPSS
HLALHLPPKPKSHQFLVRTFSSPQKCNHCTSLMVGLTRQGVVCEACGFACHLGCCDKVPV
ICPVPADQTKRPLGIDPTRGIGTAYEGYVKVPKSGGVKKGWIRQFVVVCDFKLFLYDISP
DRNALPSIYVSQILDMRDEDFAVSSVGESDVIHATKKDIPCIFRITTSLMEPYGIKNHTL
MLADSENEKSKWVVALSELHRILKRNNLPNTVVFKAKELLDSTCAFIKNAMSGVIIDPDR
LVIGAEEGLFCLDLDRYEIARIGEGKKVYQLEYIAEEQLLVVLSGKQRHVRLVPIRALDG
DDVEWIKVAETKGCITFAAGPMKKNPLSYCLCVAIKKQNTSQIIVYEITRTKARHKRLRE
LMLPTQAQTLSILSEGRLCIGYQSGFTVYSIMGDYHPVPLVHPDNQVLGFLAYSSVDALR
AIELPRGEFLLVFQTLGIYADSQGRKSRDKEIMYPAIPLAVSCLEGHLLVYSDTHIDVFN
ASTGDWIQTINVKKAKPLNNSGSLSICIINDLAYIVYLSHIHLKDAVNVTCTDSTGLQTP
VRPRKRFSIREVHRTARMTDWRSKMISAPSNFNHISHMGPGEGIQIQRLIDLPTTLETAD
SASLSSPHPTISSQDSSSRLFHPSVAPPKIPSHPPGPPIRNSPHPESQRRHSGHMTHNQG
YPVHNGSTNILRRAPPPPRPSVTPPSLPRTPSDSVNAELSHVNIGLSPLNNGSKEQSGGG
SPRHSIASNNSSNPSTPPSPGGHDHGSSSYDS
Download sequence
Identical sequences E0W264
XP_002432458.1.24195 121224.XP_002432458 vb|PHUM584760-PA|EEB19720.1|serine/threonine-protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]