SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM590060-PA|EEB19791.1|HIV-1 from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM590060-PA|EEB19791.1|HIV-1
Domain Number 1 Region: 120-223
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.17e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM590060-PA|EEB19791.1|HIV-1
Sequence length 341
Comment Rev-binding protein, putative|DS235877.1:105673:106780:1|gene:PHUM590060
Sequence
MSNNEDEEEKRPKVVENAWSLKVPEFKKEDNPHRLLEESSFATLFPKYREPYLRQYWPQI
QKVLNEYGIKGELDVIEGSMKVKTTRKTWDPYIIIKARDMIKLLSRSVPFEQAIRVLEDD
IFCDIIKIGSLVRNREKFIKRRQRIIGPGGCTLKSIELLTNCYVLVQGQTVAALGPYKGL
MEVRSIVEKTMFNMHPIYKIKELMIKRELAKDPILKNENWERFLPKFKNKHLPKKKKPKN
KKEKKPYTPFPPPQTESKIDKQLESGEYFMTEAQKQQKRKREINERHEEAKKRREEKRKL
PFIPPEEDKPKPVKQKPDDEFNVDEFKQKIKNSLKNKKVKR
Download sequence
Identical sequences E0W2D5
XP_002432529.1.24195 121224.XP_002432529 vb|PHUM590060-PA|EEB19791.1|HIV-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]