SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM591700-PA|EEB19814.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM591700-PA|EEB19814.1|conserved
Domain Number 1 Region: 13-151
Classification Level Classification E-value
Superfamily RUN domain-like 6.28e-17
Family RUN domain 0.0067
Further Details:      
 
Domain Number 2 Region: 173-241
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000266
Family PDZ domain 0.03
Further Details:      
 
Weak hits

Sequence:  vb|PHUM591700-PA|EEB19814.1|conserved
Domain Number - Region: 294-363
Classification Level Classification E-value
Superfamily PH domain-like 0.00112
Family Phosphotyrosine-binding domain (PTB) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM591700-PA|EEB19814.1|conserved
Sequence length 679
Comment hypothetical protein|DS235878.1:74335:78505:-1|gene:PHUM591700
Sequence
MGLAFKTTLEFESNGCITDASVNLLPLCNALENILQKGFIGHCWDWLEELNNDMETGVIT
RSFSFIRAVEIAKTCYKVKTPTGRLRLLIRCCLVNKCLHIPVEIAVRLYTNHRGQWYDSN
CSILGDEILGEIFLSVVLQLTTLIFKLDLSNARFLDNTFELPKYLDIEFVPCNTLGITVV
FIEDKALVVGVDEKSVAAEDNQVEVGDVLDELNGQVLRSEMRGKLNNIMNKCKAKPISVK
LIKSINKETESIFLPIKPLLRKANIDICNLKEKIICNKKDKEIEIPKIIRSGPIVNYVGH
IVIGSEGDVKQIEYAVSCILTNKNSLEIKKVYLECQELGLKVISSTSGKILLQNSFMEIS
SCGIIFAIWQKNLPVMFLKLKTTMIFKPYCKVLDRVFKELILLFELNTFSINLMSGKKHR
TIKYPEKQKEARLERLKGKVNNPPKNVDEQEIPKSLINLMKLKNKSKIKTKITRKKRKKK
DELLSVSKFLDKYPNGKIDGYIPNLVQKPSETPKSFLNRMNEMATNMIAEVELEKKFRVK
IKKDEETGKVLDIVKVKSKKRSKKKTLSEKRKEKKIEKEKESNNYKDFNHLKDELKFGEV
VHRPPDFSSLKKSKDKTQNKTNYSSLLLQNIAGEGKKLDTVNKNHQKTIFDKAKAEKERQ
FIVNAYRIAKAAKAQGKKK
Download sequence
Identical sequences E0W2F8
vb|PHUM591700-PA|EEB19814.1|conserved XP_002432552.1.24195 121224.XP_002432552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]