SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM592220-PA|EEB19826.1|voltage-activated from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM592220-PA|EEB19826.1|voltage-activated
Domain Number 1 Region: 402-593
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.31e-53
Family cAMP-binding domain 0.000000206
Further Details:      
 
Domain Number 2 Region: 98-238,286-405
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.27e-32
Family Voltage-gated potassium channels 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM592220-PA|EEB19826.1|voltage-activated
Sequence length 692
Comment ion channel, putative|DS235878.1:136420:164236:-1|gene:PHUM592220
Sequence
MKFFLKIFRNNNDYVNDNAVGKVHFGGDDVSLYGTPKEEPGPTPIGAVDSGKQSFLKNQL
QALFQPTDNKLAMKLFGSKKALMKERIRQKAAGHWVIHPCSSFRFYWDLCMLLLLVANLI
ILPVAISFFNDDLSTRWIAFNCLSDTIFLIDIVVNFRTGIMQQDNAEQVILDPKIIARHY
LKTWFFLDLISSIPLDYIFLIFNQFQDFSESFQILHAGRALRILRLAKLLSLVRLLRLSR
LVRYVSQWEEVYILQNLQKKRTERRQGRYSCDVTTNKKKFSKSNLIFKFLNMASVFMRIF
NLICMMLLIGHWSGCLQFLVPMLQGFPSNSWVAINELQEAFWLEQYSWALFKAMSHMLCI
GYGRFPPQSLTDMWLTMLSMISGATCYALFLGHATNLIQSLDSSRRQYREKVKQVEEYMA
YRKLPREMRQRITEYFEHRYQGKFFDEELILGELSEKLREDVINYNCRSLVASVPFFANA
DSNFVSDVVTKLRYEVFQPGDIIIKEGTIGTKMYFIQEGIVDIVMANGEVATSLSDGSYF
GEICLLTNARRVASVRAETYCNLFSLSVEHFNTVLDQYPLMRRTMESVAAERLNKIGKNP
KIVSHREEEEEDMGSESKTINAVVNALAEQAEQVNTEKSLHELGRASLHILNLPRPKSEI
NFAAQELGLHTNRSSKPIFHKSDTFHKESAFQ
Download sequence
Identical sequences E0W2H0
XP_002432564.1.24195 121224.XP_002432564 vb|PHUM592220-PA|EEB19826.1|voltage-activated

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]