SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM593000-PA|EEB19834.1|heterogeneous from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM593000-PA|EEB19834.1|heterogeneous
Domain Number 1 Region: 287-358
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.34e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000927
Further Details:      
 
Domain Number 2 Region: 85-175
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.72e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 3 Region: 21-90
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000351
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM593000-PA|EEB19834.1|heterogeneous
Sequence length 365
Comment nuclear ribonucleoprotein k, putative|DS235878.1:215520:220076:1|gene:PHUM593000
Sequence
MKREIDGPQGGGPQKRYKNSDGNEIRLLIPSKVAGSIIGKGGHNISKLRTEHNASVTVPD
CPGPERILTVAADLDTMLRVVSEILPNLEDVIDIRMLVHQSQAGCIIGKGGLKIKELREK
TGARIKIYSNCCPQSTDRIVQINGKGNLCVDAIRECMELLKTSPIKGMNNPYDPHNFDEY
FSQDYGGYGGGGDDRRGGGRGPGNRGPPGRGGGNFGGPRGGGFGGPRGGGGGPGNFGGRG
PMGGPMGGPMGGPMGNGMGMNAPGPMGMGMGGPGPQNPGNFGGPPLGGEKNSTQVTIPKD
LAGAIIGKGGSRIRKIRMESGAAITIDEPLPGSNDRIITISGTPNQIQMAQYLLQQRLVY
LIHLI
Download sequence
Identical sequences E0W2H8
vb|PHUM593000-PA|EEB19834.1|heterogeneous 121224.XP_002432572 XP_002432572.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]