SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM593520-PA|EEB19845.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM593520-PA|EEB19845.1|conserved
Domain Number 1 Region: 932-1077
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-47
Family Phosphotyrosine-binding domain (PTB) 0.00000416
Further Details:      
 
Domain Number 2 Region: 1108-1215
Classification Level Classification E-value
Superfamily PDZ domain-like 1.21e-18
Family PDZ domain 0.00022
Further Details:      
 
Domain Number 3 Region: 1210-1289
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000171
Family PDZ domain 0.0000685
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM593520-PA|EEB19845.1|conserved
Sequence length 1298
Comment hypothetical protein|DS235878.1:280241:288994:1|gene:PHUM593520
Sequence
MTSVVSLQLDGNDLNEQITKLFPKCRPRDLNLNPVHDDHLDNNAFIMDLDKEITRCGNEK
SEEVQEEDDEENGSQDNDSTSNEEVDFTNEDLVVDHAYSGSEGQVIVLQSSKGATYKLRD
SRIIEIAGGRELFSQSRTKALRSKLRNEPVSGILEKGSYKNKGIVNKNIWDSDSLKGNNR
EITETVFSTEIHSVKHQRSSNLPVTLSYNELGANSLNSIGGAGGSEVVVFDDIGDDNSWR
KKGEEERKGLNKGKESVSSSPSPPSYHRTPSDFFKVANTSTNDMRNKSSLDLEHNKSPKV
IGGLPIAEYDGSPRRYWPRHSDASQNAIHPPLPSAHSLLASPSVCPPRPGFPQRIVTITN
NTPEQTSGNKQGSTSASPNQSTTGNPNFDYLYEFSETRKVLEEFFKQTDNSGSHNIQDFD
ELGYELRRQAGRGSAYVGLRLAKNLVQETSQKPQKTCNSGLTEQQHQTENSREQDITEHD
CNFLDLSADSASTEDLGDTEVGLQVGHSRNFTLSPETTDCDSNCGDLDSEVSLLLVDNNM
AEQPLKIVIFFFLTDSFEKGHADQNDEGGNMQITDSLRVYSSMPILEDGLSSGHASDTDN
NNPTVVLMKRQITEIEKEIIQKQNKKSNQTVHVVNGSSKTSDSVSPVHKQQMDKNSISED
KLILNYKNNNKQNTTSRDVYENDPEIEALDPLNASQVTPPPPAPAPHRSLCIDTHSQESV
EAAIKDIRLTLQRTKTLPLKSPNSDEPNESSNSPIWVPRCKVRDSGTYESRKSRNGSEEG
IEDEEADTDLETDRLLGQQRTDDHGFYDDKLGWKKPKSRTVMPSSLINSNKMSSSTPLKS
TASNVVVPVVAAASASAAATSLDSLPKISIPPEVSTIPPSNGGLVESPLDISSSPVKDNG
VTTSLPTKTKKDKDGSKKRGRNKEVLIHEPSVLIEGVLFRARYLGSTQLVCEGQPTKSTR
MMQAEEAVSRIKAPEGESQPSTEVDLFISTEKIMVLNTDLKEIMMDHALRTISYIADIGD
LVVLMARRRYVPHDVEESSKMTRTPKMICHVFESEEAQFIAQSIGQAFQVAYMEFLKANG
IEDHSFVKEMDYQEVLNSQEIFGDELQMFAKKEMQKEVVVPKAKGEILGVVIVESGWGSM
LPTVVIANLAPSGAAARCGQLNIGDQIIAINGISLVGLPLSTCQTYIKNTKNQTVVKLTV
VPCAPVVEVKIKRPDTKYQLGFSVQNGVICSLLRGGIAERGGVRVGHRIIEINNQSVVAV
PHEKIVNLLATSVGEILMKTMPTSMFRLLTGQETPLYI
Download sequence
Identical sequences E0W2I9
vb|PHUM593520-PA|EEB19845.1|conserved XP_002432583.1.24195 121224.XP_002432583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]