SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM595630-PA|EEB19866.1|sorting from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM595630-PA|EEB19866.1|sorting
Domain Number 1 Region: 150-284
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.07e-19
Family Regulator of G-protein signaling, RGS 0.0049
Further Details:      
 
Domain Number 2 Region: 381-462,499-515
Classification Level Classification E-value
Superfamily PX domain 0.0000000034
Family PX domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM595630-PA|EEB19866.1|sorting
Sequence length 723
Comment nexin, putative|DS235878.1:507110:510329:1|gene:PHUM595630
Sequence
MDLTDIILDHLVTIGFRHVNDYNKILELSLKEKISIESASVKYLGKRLHFAVRSRETELQ
YLRCLSDLLINHLLQKSQLNCLSFKVLIKEILAGWVLLSLTDVLSDPYYINSLILLALNH
EPLTNYPDNSDSKVQFLQKFVVYDEENINKKSVLQSNLSSIFKDQKLLYQFMQFLKREGA
VHLLQFCLHVEDFSKKILNPELNESERESLFNEAWDLYSVYFNADSPDSIHFPSNIVDQM
KQNSGPSNIVKLVNNPVLFMAYEVAYSILDDNYYPLFYLSDEYFILLCGEKKPKKSPKGN
YSSPVQPSSPVRGRYLKKNEKTEMSVVGKISNKFNKLLQFQPAEGRPCYNDSPLVLGEAE
CVEELDIESLSENEPRDMSMWRVNISHVTTKQDSNSKPYPVFNVIVSNIDVKDGKSPKSK
SKWTVERRFNDFYILQAKLAEFHGEFEDGTQLPPKSGIFSPREMIFSKVEDNPAEFSSCL
SAQDGIGRIIRKSVEPIKLRKERGQHLENFLTVFLSSTEGSKKSGKYEWQDVSVVPPRKK
RDTTQTIFKNNFKEFLTTKTEEVHCGEQQVLNLVGSWDCIFYVLSNLMGASNRFLQIVMG
LKKFLGQSADSVVKKILRDELKPLLVSARISHLIRLLQDAIFSSKNNAKKSNQVVLRGKI
TAEIEKLTNNNFLQEFLPKFGQGMEKMIDSIQNPILNKNLCYYLLDEIVRILFPEIILTE
NYE
Download sequence
Identical sequences E0W2L0
XP_002432604.1.24195 121224.XP_002432604 vb|PHUM595630-PA|EEB19866.1|sorting

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]