SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM596350-PA|EEB19909.1|prefoldin from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM596350-PA|EEB19909.1|prefoldin
Domain Number 1 Region: 13-119
Classification Level Classification E-value
Superfamily Prefoldin 1.02e-24
Family Prefoldin 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM596350-PA|EEB19909.1|prefoldin
Sequence length 127
Comment subunit, putative|DS235879.1:451986:452704:1|gene:PHUM596350
Sequence
MSKVVQVDLELKKAFQELQAKMIETKQKIKMADIQIEQLNHTKAHSKLTQTEILKLKPNN
KMYEGIGRMFVFTDKDTINQHVQERYDKADEKIKTLENSKSYLERSLKDSENNLREMIQQ
RKDKGEL
Download sequence
Identical sequences E0W2Q3
121224.XP_002432647 XP_002432647.1.24195 vb|PHUM596350-PA|EEB19909.1|prefoldin

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]