SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM596920-PA|EEB19945.1|cGMP-dependent from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM596920-PA|EEB19945.1|cGMP-dependent
Domain Number 1 Region: 724-1036
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.07e-81
Family Protein kinases, catalytic subunit 0.00000021
Further Details:      
 
Domain Number 2 Region: 578-700
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.54e-32
Family cAMP-binding domain 0.00062
Further Details:      
 
Domain Number 3 Region: 458-571
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.67e-28
Family cAMP-binding domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM596920-PA|EEB19945.1|cGMP-dependent
Sequence length 1045
Comment protein kinase, isozyme, putative|DS235879.1:1086298:1090451:-1|gene:PHUM596920
Sequence
MENQKSDKEENDEKNSKRILRKELLSSSTDFRKNSTNMNESSASSSDLSTTYSWSPISYA
KHSCGSLFVKCSQHGKWPLLQTFTNRKSPLYQKTFPGRCATLRSKKPEDYVMRRKKWNKD
DEENENVLKNLSFEREPEKTLSHSSETKTNAGILSRKCGKKTKNKVKFDTKFLKMEKSNE
QTESRFATTQNMIIKRRNSWTDRVGFVEKINEQQQQQQKTIVHRENVSISRSKNRSERDE
RSTSCDKTSKNSFTKSVKMVQNNDDVEPSRKYDRNHPKRSFKTSANQDERQRKRSEKINK
KTNKNYESEPEDEKKVLQKRDENLKINLQNYDQNETERLRTIVASLSNETNEQEEKIDFL
QTEIFYLRKELKKKDRENVKLHREIHKLKSVLQDARVFKREGDLLSSLQESHGMPGQFQQ
VINIPNPNKKQGVSGESSDHGQNHHQIEIQRFEKDFRSKQLIKDAILENNFLKNLDTVQV
REIVESVYPKKFSKGDYVVREGEAGSHLYVSAEGELEVIKDQNVLGRMGPGKAFGELAIL
YNCRRTASIKVVSDAKVWVLDRQVFQKIMMKTGLQRLQENLNFLRSVPLLQSLNNEVLAK
IADVLEVDFYPSGEHIIRQGATGDTFFIISSGSVKVTQEKPGKDEEEEIRILNKGDYFGE
QALLKEDCRTANVIALSPGVEVLTLDRESFIQLIGDLSELQEKDYGDESRNFAKFSSCSS
LTDKQEFEYIRLQDLDIITTLGVGGFGRVELVQYSKNKSMAFALKCLKKQHIVETRQQEH
VYSEKNIMMACNSPFICRLYRTFKDSKYVYMLQEALLGGEVWTILREKGCFDDYTTKFIT
ACVIEAFEYLHTRGIVYRDLKPENLLLDSIGYTKLVDFGFSKRIGFSSKTWTFCGTPEYL
APEIILNKGHDRAVDYWSLGILMHELLTGIPPFAAPDPMRTYNIILKGIDVIDFPKHITK
GAQSLIKRLCRDSPSERLGYQRGGIQDIKKHKWFQGFDWSGLKQRALIPPVAPIVRSPTD
TSNFDSYSKETVVPPDEFSCWDAKF
Download sequence
Identical sequences E0W2T9
121224.XP_002432683 vb|PHUM596920-PA|EEB19945.1|cGMP-dependent XP_002432683.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]