SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM599810-PA|EEB20011.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  vb|PHUM599810-PA|EEB20011.1|conserved
Domain Number - Region: 40-97
Classification Level Classification E-value
Superfamily PH domain-like 0.000707
Family GRAM domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM599810-PA|EEB20011.1|conserved
Sequence length 378
Comment hypothetical protein|DS235881.1:189090:190938:1|gene:PHUM599810
Sequence
MDSVLMAVVIPRSQKPSLYATMPFWEDNEIRFDVPFTQMKLRTAEKLIDKLDSVEDTKGN
GGDKGRLIVTNLRILWHSLSSPRVSLSIGLNTILNATTKNVISKLRGPVEALYLLTKTAN
NKYEFIFTNLMPGTTRLFTSVIGVHRAYLSSKMYRELKLRGAIIKHKQLQLLPLEQIVRT
ENGVWNLSSDQGNLGSFIITNIRIVWHADMNEHFNISLPYLQIALVKIRESKFGVALVIE
SVETSGGYVMGFKIDPQERLKMVYKEILSLHTVYSKCPILGVEYTLSNEAILPEDPPTLP
EPEKELDLSSEIISRAINSYIADDDPESMPRPPVYCPDLGLAVEELKEGFTMQDLWEVLP
PSEFVQKQNAERIANNIP
Download sequence
Identical sequences E0W305
vb|PHUM599810-PA|EEB20011.1|conserved XP_002432749.1.24195 121224.XP_002432749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]