SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM602870-PA|EEB20128.1|1-phosphatidylinositol-4,5-bisphosphate from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM602870-PA|EEB20128.1|1-phosphatidylinositol-4,5-bisphosphate
Domain Number 1 Region: 319-677
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.57e-125
Family Mammalian PLC 0.000000014
Further Details:      
 
Domain Number 2 Region: 941-992,1021-1186
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 9.29e-40
Family C-terminal domain of PLC-beta 0.0011
Further Details:      
 
Domain Number 3 Region: 16-145
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-39
Family Pleckstrin-homology domain (PH domain) 0.0000688
Further Details:      
 
Domain Number 4 Region: 207-315
Classification Level Classification E-value
Superfamily EF-hand 8.32e-27
Family EF-hand modules in multidomain proteins 0.0015
Further Details:      
 
Domain Number 5 Region: 696-813
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.37e-22
Family PLC-like (P variant) 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM602870-PA|EEB20128.1|1-phosphatidylinositol-4,5-bisphosphate
Sequence length 1197
Comment phosphodiesterase, putative|DS235882.1:894068:950292:-1|gene:PHUM602870
Sequence
MSASRVPAHIALLKPVEVPQSLVNGEKFVKWEEDSGTGTPVTLRVDKNGFYLYWVDQNNE
MDVLDFAIIRDARTGRHSKVPKDPKLKSVVTMGSQDTLEEKTITVCCGSDFVNLNFINFC
CTKKEIAQVPEGGWVDGLLKTFSDLTNKPDIILRHNAEKWCKLIEVSVPAEKNTTAKEAD
KRLKYRNLEIEITRMWGTKTETIPVININYIYIYKFYAFVSTYNYPTLLFSCSCGTSSKR
KFLTAEKFVTFLNKTQRDPRLNEILYPYANPARAKDLIQQYETNKMNAQKGQLSLDGFLR
YLMSEDNPIIASSSFDLSDDMDQPLSHYFINSSHNTYLTGHQITGKSSVEIYRQCLLAGC
RCVELDFWNGRIDEPVIVHGYTFVPEINAKEVIEAIAESAFKTSDFPVVLSFENHCNPRQ
QAKIAQYCREIFGEMLLDTPLDSHPVKPGSFLPSPAVLRHKIIIKNKKKHHHHHKKNHGG
FRSNTMDSTTTPADVVTGNGDIPHAPPLQTRQGSKESQNEDDENEEEEDVEEMKLRGNSS
GEKPTDKSASAKETEAGAEISALVNYIQPVHFTSFEVAEKKNRFYEMSSFDEKQATTLLK
ERPIEFVNYNKFQLSRVYPSGKRFDSSNFMPQVFWNAGCQLVALNYQTLDLAMQLNLGIF
EYNARSGYLLKPEFMRRKDRRLDPFAESTVDGIIAGTVSIQVISGQFLSDKRVGTYIEVD
MYGLPADTVRRKFRTKIVPNNAINPQYNEEPFIFKKVVLPELASIRITAYEESGRFLGHR
VLPVPGLCPGYRHVTLRTEAGQPLPLATLFLLIVVKDYVPDGLSDFAEALANPIKYQSDL
EKRAQQLSVLTDDCEMESNNDVSGCDCRRRRKIKRVIASVVVSMPPEPSDNAMPKFDLDS
SIVAETSSHSSPNTNKTTGTTTTTTTTTTTTHLSSSLNDVLVADSLEKLMENKVVKEKKQ
ELDKKLDVLRKKHDKERQRVTSSDCDKSKTKFYTNKLVKRLSSKNIDLGFSTHEPLDYAE
SDDSTKGSLLRTNSERLITICKDYYNQERELKEKYNETIFNLVEKLMKNSQSNQLKNLKV
LLEKETESVMRELQAARRDEVKKLSKIHKDKDEMVRIKREVDSAMIDRGVHERVRLTQLY
DRKREDLERQHEHVRQCLEEERSKVFKANLLKDHEMKVARLEEEMLSPSSSQGNVKV
Download sequence
Identical sequences E0W3C1
XP_002432866.1.24195 121224.XP_002432866 vb|PHUM602870-PA|EEB20128.1|1-phosphatidylinositol-4,5-bisphosphate

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]