SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM605280-PA|EEB20205.1|afadin from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM605280-PA|EEB20205.1|afadin
Domain Number 1 Region: 1005-1116
Classification Level Classification E-value
Superfamily PDZ domain-like 8.28e-25
Family PDZ domain 0.0001
Further Details:      
 
Domain Number 2 Region: 309-403
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.18e-23
Family Ras-binding domain, RBD 0.00022
Further Details:      
 
Domain Number 3 Region: 430-535
Classification Level Classification E-value
Superfamily SMAD/FHA domain 5.59e-22
Family FHA domain 0.0000489
Further Details:      
 
Domain Number 4 Region: 121-213
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.79e-18
Family Ras-binding domain, RBD 0.019
Further Details:      
 
Domain Number 5 Region: 44-120
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000189
Family Ras-binding domain, RBD 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM605280-PA|EEB20205.1|afadin
Sequence length 1961
Comment putative|DS235882.1:1831822:1853279:1|gene:PHUM605280
Sequence
MIATDPKMKKDAEREALRAVIQQWNANRLDLFELSEPNENLEFHGVMRFYFHDSGQRIAT
KCIRVASDATVTAVIETLIEKFRPDMRMLSVPEYALYVTHENRDERRLNPDEKPLLNLEF
HGVMRFYFHDSGQRIATKCIRVASDATVTAVIETLIEKFRPDMRMLSVPEYALYVTHENR
DERRLNPDEKPLLVQLNWHKDDREGRFLLKRIDDKTKMPSDSFQESSFRRKLSKREKKQM
KKQEKLNRLKSSGDADEGSVAEKLYTELPETSFTRSISNPEAVMQRRRQQKLEKKLQQFR
SKDGGPDTGGTLKIYGEALCGDVPYKTLLLSVGDTTTHVVKEMLSKYGMDKEDAHNYCLV
QVNTGDPLGPTEYILDEDECPLAILMNHPSTSGSIMFHVRRRPADYHPRKRKKKPQQKWQ
RDVDGKYEDGLPFFLELNPDGSEIMSGTAKRHVLHPNVTEVGLERTGGPNLQLFGPNIQP
RHCVIAHTDGLVTVTPCSRDAETYVNGQRIYETTILQNGAVVKFGRIHNFRFIDPMGDDR
TGRNRHPEFGYDRLSKDDNNTLVHPSNSNLTNYETTFDVDGNVETVSLKDMDSRSQRSIA
SSRDGNRLSNYERYPRGSDPILPAVLEIREDAEEAFLHSVIIDLDPNVPAFKLAPTYTLY
LTARYRASTHYRPELTPTERAHRLTVLLARIASMIQHVVQERYSEPKSLAFWMANASELL
HFLKCDRHISAFSLDAQDILAESVQIAFRNLVACHQGELTSAMSHFLSERDDAPNTVLLV
LSSAMALLRRCRVNAALTIQLFSQLFHFVKMMAFNKIVTSPSQPQGINYCSRAWGIRLKE
RVSQLGTWAERQGLELAANCHLGRLAEAAYLLEAPKYNANDLAQLSSTCLKLNSLQLRAL
LRGYQPQHDEPKLPLELIDNVVHVAENVADELARSDGREVKLEEDVELQLPFLLPEDGYS
CDVVRGVPQGLTEFLQPLQSAGLCRMNVQPTSSGQWTIYMTEPMTNLRSPSAMSNRLPAT
QQPLEIQTIRLHKSNNGMGLSIVAAKGAGQDRLGIYIKSVVAGGAADVDGRLQAGDQLLK
VDGQSLVGITQEKAAEYLVRTGPVVTLEVAKQGAIYHGLATLLSQPSPLMARGPRRMSER
DLPSRLHSEDAKKQQLPPHAPIQSSKSVPSLHSAQGPEPRQQEVFNPGYSRTSSTNSIPQ
SALRSRSNQNLSEMRPPPSKSVATLQSGSLYPTQSTPSLHQSQNYSGQPGYSNQSALSYT
ANNSGYQPDATPTSNYQGSMNASVTSPYSNNRTNPNYTTPVSNSSSSYVASPPMGNHYPN
HPADGQYHSTPNSSQTVVNNQYSMQQGNANPSGGGGSGGGGGGGGPYHGAPPMNQYQGNS
PGNGNHYQGSHGGGQYLGNSHNASYQGPPSTYHYPGNQYQGTAGPHNVYQQYQSPPGNFA
GTNNHHQGDSERFYQNLSVYRNQDGYGKNKILPPEDRQEAKFQEMTEEVRRRELRGGPPP
GRPNVSFGPPPVAPKPLIGEEYRESPPPPPPPTTTHPLLQKANSTPDNRYQASLSEPPRG
GYYPASSGDRRQYPYTGTNPWEREEKEKVRPKRREAARQWREQQIAELSSIPSRTSQQEE
QLRALILEKEFEKRAEEAKHEDEDEGEDESAVVVREFENRSSSERVQNLLRMAQHQNGPI
IRPATASIAQMKLEEVRRQHAQGQTLNLRVNHSKPPPPMNVNVNVNDLRFENLSVNDTHH
LYNDYMEEKHNGNHAMDRSPSYPSPMPNNVGVLKSPINPMTVQPTKRVSFSDPNANQISN
HNNLNNTYNNINNNNNNHNSSSSGGGGGSNNSNHHHNSSSNNNNNNNNSMEKIIEDPNNF
INEAENLLQSPKTPEGAPSFAGNTPGVIGAQEVYRDPRQRLLAEQKQNSTPKVPGPEKLS
FKEKMKMFAMETGEDGTPRDKVKISRAQRDIDNISSPLGNS
Download sequence
Identical sequences E0W3J9
XP_002432943.1.24195 121224.XP_002432943 vb|PHUM605280-PA|EEB20205.1|afadin

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]