SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM606710-PA|EEB20227.1|still from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM606710-PA|EEB20227.1|still
Domain Number 1 Region: 1581-1744
Classification Level Classification E-value
Superfamily PH domain-like 1.02e-62
Family Pleckstrin-homology domain (PH domain) 0.0000483
Further Details:      
 
Domain Number 2 Region: 1379-1586
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.33e-52
Family DBL homology domain (DH-domain) 0.000000424
Further Details:      
 
Domain Number 3 Region: 38-144
Classification Level Classification E-value
Superfamily PH domain-like 1.16e-21
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0081
Further Details:      
 
Domain Number 4 Region: 811-921
Classification Level Classification E-value
Superfamily PH domain-like 7.77e-18
Family Pleckstrin-homology domain (PH domain) 0.0085
Further Details:      
 
Domain Number 5 Region: 1167-1247
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000028
Family PDZ domain 0.015
Further Details:      
 
Weak hits

Sequence:  vb|PHUM606710-PA|EEB20227.1|still
Domain Number - Region: 1089-1131
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0134
Family Ras-binding domain, RBD 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM606710-PA|EEB20227.1|still
Sequence length 1788
Comment life, sif, putative|DS235882.1:2331127:2387299:-1|gene:PHUM606710
Sequence
MGNKLSCSCAPLIRKAYRYEDSPWQTSRRRDGHLLRYRLWAEVFHVSSGTGTIKWQQVSE
DLVPVNITCIQDSPECVFHITAYNSQVDKILDVRLVQPGTRIGQASECFVYWKDPMTSDT
WGLNFTSPIDAKQFKECCSPSFKFSRKASSSYSLKLDPPNKQKIKTKRKPLSTPASPSRS
REPQCTCMTAEQYARLRAQDPRYRRGSSTLPRATTRATETDTGVRSEKVTAATSSTSLYD
NVTGNKTQQTRSTSAGENTGTKTTRDRGTQQQTDSGTMTSTTGKQTVIQNHIGSQVSFFQ
NEERNETTTEKCKSEGTQAGGTLSQISTQTSHKNQTNKNRDHHHHILTSTRSIDYDIDLV
PMSKSTDDMRDEQRDMNLDSNTLKKMLKPMMSNESPATSPEMTRRRYASSNYYNTHHPSH
YGHHQYREHQFNNRNVMSDVEGTPRGHRKQIITDRERNARFSGSRSSHEIGRGYPNRDRG
LYLELERTGVPPPDMSPPSDNVLFDNQCYATTPSSSNGNSDLDAPTTNYRGGHYRTPSAP
GSPTSRLLLEYEMHLRNTLAKGMDAESYSLHTFEALLSQSMENLEFAESIPTTKSSTLPL
SNRLSFERPPNSTRDREGYYSDRNELMRERERDRGYLSDHNTSSRCASCLGESARAQWFR
HSDGWRSGSSALGSGTGSGIMSQSSISSHKRSPWDSLPSLRHDNSRDDSSYKSMRGDSFD
QSSIFDRQDSQRSDYISARDSRYGMVQQASVESADSRLCYLTSSEMSDEDRMSLTTAVSD
EEDGESVHNSPYRAKQTGTAAASFNCTGAVRKAGFLSVKKWLLRKKHQIELARKRGWKGY
WVCLKGTTLLFYPCDSREGRSVEAAPKHLIIVDGAIMQPIPEHPKRDYIFCLSTAFGDAY
LFQAPCQVELENWVNSIHSACAAAFARHRGKTGTLHLLQEEIFRLEKAIESLTSFQISID
LQQSVVSDPETKQQIYGQIVEWEENLERLHCEQFRLRCYMASLHNGELPNPKSLLTHVSR
ATKNTLNKLGVFTVSSFHAFICARSPSLLNNLLAGRGATKRRPPMLSRSNSGSSRRSLQM
NSKDESEKSVKVSLPDNQTAHVYIRESMSVEEFLASACNRKNLNAMEHFVRVKKRRDMED
HNYFVPHRTDLIETYLHTHEIVEVCAKILYQVELQRTTLEQMWGFSVEAELIENADKQDE
LCCYVSRVEDKSVAMQNGIIKGDEIMVINGAIVSDLDMMYLESVLQEELALCMMMRSSRT
EPPDLTAVSGIMRSTDDIIESLVCPPPPSDPPVISEEMISGLIVPAPAWSKELYSPDEPE
TSPAVSSENPKATSRTNSFEIENLLKTAEQVTARNSPTGSVASQQLQSIYPPGRQLTHAE
KLRKVILELVDTERTYVEHLNNLLENYLKPLKKETFLSNAEINALFGNIQEIVTFQRLFL
QNLEESLKLEPDFHKFDHPSQFKNVLLSIGSAFLYYVNYFKLYSSFCASHSKAQKVLHPN
EGNQALQEFLAARNPRQQHSFTLESYLIKPIQRILKYPLLLQQLRNLTDPQSNQHQHLVE
ALKGMEKVAEHINEMQRIHEEYGAIFDHLFRQHQKSCKQPIDLSPGDLLYYGGVEWLNIS
DFLGKIKKGLELHAMCFVFKSAVVFLCKERLRQKKKLMGVSSKSSSNEVEIIRYQVLIPV
TEVQVRASSAKDMDSHFLWELIHLRSQLHRRSEKVYVLSNSTADFRNAFLKTIRQIIRES
VRNMSIPATKPGNSSLNGALTLPKPPPRDFSTSSKGSTSGKKKKKKFR
Download sequence
Identical sequences E0W3M1
XP_002432965.1.24195 121224.XP_002432965 vb|PHUM606710-PA|EEB20227.1|still

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]