SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM607650-PA|EEB20241.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM607650-PA|EEB20241.1|conserved
Domain Number 1 Region: 158-262,295-561
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.45e-135
Family Myotubularin-like phosphatases 0.0000000742
Further Details:      
 
Domain Number 2 Region: 48-135
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000574
Family GRAM domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM607650-PA|EEB20241.1|conserved
Sequence length 875
Comment hypothetical protein|DS235882.1:2532213:2535716:1|gene:PHUM607650
Sequence
MDNEQPSSIQSICHVRASELFPKRTLEKEEKHLQVPYKTICGEAVEYLGRTADGILALSN
YRIYLQLKDTYYNIPLGLIEIIEIREIFYLYIGCKDARSLRCTFSTNEHCQDWFRRLIKA
TSPPKQIEDVFAFAFHAWATEEGGEEVLSRLSSKDGEYYYFKSEVDRLKFDVNGAWRISQ
ANSEYKLCSSYPRQLLVPACITDSTLEQAAQFRSARRVPAVVWRHTGNGAVIARCSQPEV
GWLGWRSSEDEYLISAIADACAFDKGRNTSIDNLDDYQTDRITPTVNIDKEHMSSTKKVL
IMDARSYTTAVANRARGGGCECPEYYPRCEIQFMNLANIHSIRKSFQAIRQLCSIPEPSN
WLSMLESSRWLQHMAGLLRAAVAVAAAIEKEARPVLVHCSDGWDRTPQIVALAQILLDPF
YRTIEGFQVLVEREWLDFGHKFAFRCGHSVRYEELNERCPVFLQWLDCVHQLLIQFPCSF
QYSQDYLVKLAQHTYSNLFGTFLCNCSQERNVCKVSERTFSVWKFLKGSNFKNHLYEDVS
EVLWPSCNVRDLVLWSEVYIGSLEAAVTKLLGPNEENLVTNGLSVLGLGKTRSYGDLTTA
TTTEESQSPLVQGRRSSHPNIATEIKLESLQLKNSDIESLVMPIDKCVLNGKQSEEEKEE
KRREEEEEDDDEEEEDDREMDSILTSSIFSNGDSNHIHEDLNGTVEELQDRRFSEKPLSD
SSEEEEQTSSETWRSEETIIARQKFVETNNNNGNSIGNNCNAGSSNISNSNNNNNTNNNN
TNRKSESGESVVSEISENPVRRKNRTISEELYENFVNKTETHFDVCGSLEKLNSEEERIP
SLVSSTGTLVNGVVVTSSSCGGDACRICVNTPNKK
Download sequence
Identical sequences E0W3N5
vb|PHUM607650-PA|EEB20241.1|conserved XP_002432979.1.24195 121224.XP_002432979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]