SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM612110-PA|EEB20329.1|phopholipase from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM612110-PA|EEB20329.1|phopholipase
Domain Number 1 Region: 300-500,703-748
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.14e-38
Family Phospholipase D 0.044
Further Details:      
 
Domain Number 2 Region: 751-973
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 4.26e-26
Family Nuclease 0.034
Further Details:      
 
Domain Number 3 Region: 57-133,165-201
Classification Level Classification E-value
Superfamily PX domain 0.0000000000000131
Family PX domain 0.0086
Further Details:      
 
Weak hits

Sequence:  vb|PHUM612110-PA|EEB20329.1|phopholipase
Domain Number - Region: 249-322
Classification Level Classification E-value
Superfamily PH domain-like 0.00177
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM612110-PA|EEB20329.1|phopholipase
Sequence length 1107
Comment D, putative|DS235883.1:561178:566259:-1|gene:PHUM612110
Sequence
MQDVDEYDELPDDVERGTIGSILFDEKEDGEGKEVPFLSVHNEPVGFKSRKRSIFIPNTP
ITAKIIKYERSVTTHLLHPYLYTIELQHGNFTWVIQKRYKSIQFLHQQLKLFRATLMIPF
PTEKHRNDRENFKELKKSGENEEGKSKTALPRFPNKPEVLIGYDQIDKRVEQLEDYLNKL
LNIKLYRDHPETIEFLLVSHYSFIKDLGDKGREEFIEKQTGSMQRSCDCFGLLEALNCCG
PCSDFCTYNCNRWKKRWLFVKDTFLGYVRARDGLLRGIVLFDQEFEVASAFSNVRRRDKL
QILNLQRRLLVKCDGSKKRQDLSNYIKETAKKQGYGFTHDNKYSSFAPKRSDCTASWYVD
GSSYMSAVADAINSAKEEIFITDWWLSPEIYLKRPVLRGNHEWRLDCLLQKKANEGIKIF
VLLYKEVKQALGLDSNYSRNTLRKLHSENIKVLRHPDHAKSGVFLWAHHEKIVCIDQTIA
FLGGMDLCYGRWDTFEHRLSDFGGIHCSTCSFPGCYFPPEQPKWTEEIDVFENLMSKETT
VESFDVNPANLSKEFIDRETSHTQIQTRETESKQKKESLINGNINFINNEMETPREPEEV
KCDTPELERKTFMQRMSECVSGNCFSAFSNEVPAEETAEMIMDEVDSKEVNHKEFERNDS
RDELNAPPVVYWIGKDYTNFLLKDFCDLDSPFQDLFDRTKTPRMPWHDIGVMVHGHAARD
VARHFIQRWNAVKIEKVKKLHFYPYLMPKSYDHFDPPPKELTDPQYKVKCQVLRSVSAWS
AGFLNPEAYEESIHRAYLECIIKSQYYIYIENQFFISLARQNDLLKNRICEELCTRIVKA
HAEKKKFRVYVIIPLLPGFEGEIGRRSGTSLHAITHWNYSSICRGSYSLLEKLKEMGVEN
PSDYITFHGLRKYSEFHETYVTELIYVHSKLMIVDDKIVICGSANINDRSLLGSRDSEIA
VILKDEEFVEGYMNDEKVPVGRYASSLRKYLFAEHLGLLSQCHRHDSGDRIGYRDLVDPI
SDDFYTKWVSQSNNNTTYFEEVSTFREFKAYCKEEKLIDTDFESAKELIEKIKGHLVDLP
LEFLKSEDLSPKLTDGMTGLMPMTLWT
Download sequence
Identical sequences E0W3X3
121224.XP_002433067 vb|PHUM612110-PA|EEB20329.1|phopholipase XP_002433067.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]