SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM613940-PA|EEB20372.1|Centaurin-beta from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM613940-PA|EEB20372.1|Centaurin-beta
Domain Number 1 Region: 5-283
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.27e-71
Family BAR domain 0.00084
Further Details:      
 
Domain Number 2 Region: 399-514
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.31e-43
Family Pyk2-associated protein beta ARF-GAP domain 0.00012
Further Details:      
 
Domain Number 3 Region: 259-360
Classification Level Classification E-value
Superfamily PH domain-like 2.36e-29
Family Pleckstrin-homology domain (PH domain) 0.0054
Further Details:      
 
Domain Number 4 Region: 655-780
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.22e-23
Family Ankyrin repeat 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM613940-PA|EEB20372.1|Centaurin-beta
Sequence length 827
Comment putative|DS235886.1:56838:60433:-1|gene:PHUM613940
Sequence
MKPIIEFQECLRDSPKFRAVLEAEEANIDLLEQRLDKVLKACGLMLEMGKTYVIHQNLFT
NSLWDLSSYFKEDVEIVSYLNKLIHSLQEMNKFQTILLDQANRIITRNLTSFIKNDIKKV
KESHAEFEKISSLFDSALSRNSQATKSKPNEMEEAQNLLSATRSCFRHTTLDHVYTVSVI
QTKKRHEILGTLLSYMQACSTFFHQGSDLCEDLELFFKKLGDDLNKMSSETTKLEKEMEN
RHSYVNNCDIDVTENLSGKSPVMEGYLFKRTSNAFKTWHRRWFVLQDNQLVYRKRSGEEA
VTVMEEDLRLCTVKPAVDCERRFCFEVLSPSKCHMLQADSNEMYTAWINALQKGIGAAIQ
SLRMDTDSNELGETDGDDTSTSSHSRSESEGSEKLKRPRIWEQLLKIPGNDFCCDCGNSS
PRWASINLGITLCIDCSGVHRSLGVHYSKVRSLTLDAWEPEILKVMAELGNVIVNKVYEA
NVPEDFVRATPNCSGNVRDSWIRAKYIEKKFVKKISVMPESLNIVDLRSSRNTVPVRKWS
VRKLRRRPRSSDGKGSRKQKLTSNLFSVDEINDKSCVNDNINKSLSDLTSSDKENSCCQN
TDLSRSCDDLAKSSDLLLFGEDLNKHPVGGSIELPSDQDSTGGEDENEITGEEDIANFHP
NLLLYKAAAAHNLPVMCEALALGADKHWTNSEDFNRSSLHQAINSGSVMACEYLLLNGAM
MNVQDVEGNTPLHLATELGHTAQVCLLLKHRADQHIKNLKEVEPLSIAVENANADIVTLL
RLGLLNEEMRDSELGSPDDMFNDVVRDFSQLAYLHPERLVRKNDESK
Download sequence
Identical sequences E0W416
vb|PHUM613940-PA|EEB20372.1|Centaurin-beta XP_002433110.1.24195 121224.XP_002433110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]