SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM613950-PA|EEB20373.1|Rac from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM613950-PA|EEB20373.1|Rac
Domain Number 1 Region: 362-545
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.94e-46
Family BCR-homology GTPase activation domain (BH-domain) 0.00015
Further Details:      
 
Domain Number 2 Region: 271-341
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000192
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM613950-PA|EEB20373.1|Rac
Sequence length 585
Comment GTPase-activating protein, putative|DS235886.1:61138:64124:1|gene:PHUM613950
Sequence
MSWESSLLAILDELRQSILLLQNDCTEEFLTFVTHQEQCRQKWQESVLECQRLKTDLDLR
NVRLRDYEKKLNRARCLLDSEKRKRIKAERERDELQEQVTQIEEILSSVRHAGDKLANET
KEKLDKFLNTTYSKLKTNTNVLGYHLDTIDEINSSLLSDLSYTKSDDFVECDTGSDRGIP
KKPLRSTSPDINEFQINKRRKSSWAQNKIKKIEKISSDQVIARTTLTLSKQGPIIASSTI
ETFPDDFPQDTKPSAPPKLSSDTDSDVTEAINCFHHNSSPIYSKNKLFNRPHSFRNKTNL
KPTEECGVCIKKIMFGNKMFYCSDCKVMVHPECKDKAPMPCLAVVATPRGTSGTTIADFC
SRTPPMVPPLIVHCVFEVEARGLGEVGIYRIPGSEKDVRALKDRFLRGKGICSLSGYDIH
VVCGTIKDFLRSLGEPLVTFSLWPEFIRASENEDVSERTSALYQAVSQLPQPNRDTLAFM
MQHLQKVSQSPDCKMSKSNLAKVFGPTIVGYSRIEPVRNEMYVETAQQTQVIECLLDMPG
EYWYNFVNNEPDENIQPSTPVLSLNYRRLNRNKNRKVFNTPPVTK
Download sequence
Identical sequences E0W417
121224.XP_002433111 vb|PHUM613950-PA|EEB20373.1|Rac XP_002433111.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]