SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM006440-PA|EEB09953.1|SET-binding from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM006440-PA|EEB09953.1|SET-binding
Domain Number 1 Region: 1124-1258,1339-1553,1593-1645
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.12e-104
Family Myotubularin-like phosphatases 0.00000509
Further Details:      
 
Domain Number 2 Region: 1807-1979
Classification Level Classification E-value
Superfamily PH domain-like 2.03e-29
Family Pleckstrin-homology domain (PH domain) 0.0000377
Further Details:      
 
Domain Number 3 Region: 1770-1829
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.89e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0017
Further Details:      
 
Domain Number 4 Region: 893-1036
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000861
Family GRAM domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM006440-PA|EEB09953.1|SET-binding
Sequence length 1980
Comment factor, putative|DS234991.1:127073:136507:1|gene:PHUM006440
Sequence
MSRLADYFVIVGYDHSKERSGVSNGVILQRFPNTDWSDTPFIEGIELVGILQFICWALST
ERQEPKFFVSVLTDIDANRHYCACLCFNETVSITPSKPVDEEEDALENESGERLGSLGRT
SILPISHYSIMYAPKCLVLVSRLDYIDTFRSCLGLIYTVCIENINVPLETLVGNILGCIQ
VPPPGGPQVRFSIGAGDRQALQPPLSPSLPVTHTSVNLLFQQLGIRNVLVLFCAIMTEHK
ILFHSKSYTRLTEGSRALTALMYPFKYTHVYIPLLPAALLEVISTPTPFIMGIHSSLKPE
ISDLMDVIVADLDGGSIQLPDRVSLPLLPEPFLSQTQESLSLVLQPELSWADHAFPPLAM
RETQPALLDKEIRAVFMRTFAQLFQGYRSCLTIIRIYPKPVITFHKLFYQSLIDCEFTTR
VLDCMFFTGFVSERGPPWRPCDVWDELYNNIGELLKIETQDPKKLLNHIQELGQQLYVNE
NPNHQPYVQKILKPPEGAFTRIHHPPLPQLDYAKVQAIIDEGMIKNNLKARLSSLRPAQP
RIVPNGPHISTISDNRPGISDSARRLEVLKNCINCIFENKISDARKTFPAVGRALKSKAA
RLALCSELSQHVVGNKAMLEHQQFDLVVRLMNCALQDDSAMDEHGVAAALLPLSTAFCRK
LCTGVIQFAYTCIQEHPVWQNQQFWESAFYQDVQRDIKALYLPRMEINSLPPSSPRDSRE
FPFRNYSRIQEPSALEIAAEQMRLWNAYTPEKQQELVCSEESTLYSQAIHYANRMVYLLV
PLDIASRAHKQESNLDEERTSNCNTNSVAESDSADAESGFEEADPGETGAAVIRTVSRFV
DKVCTEGGVSYEHVRALHLMIPGVVHMHIETLDAVYKESKRLLPIQKPKILTPTMLPGED
LVMEGLRVYMLADGRDEVTGGTFGGPPLLPAEGAIFLTNYRIIFKGTPCDPFACEQLIVR
AFPVTSLTKEKRVNNAQYLPHLEQWLNEGLQLRSCTFQLLKLAFDEEVTQESIESFRKML
QKVRHPPDIFHYFAFIGQVVVSQTPLHKGKEKNVTLKGFAKKTLLKTARKAGFKPKTSSK
RQKYVFPNLSSQKYLTSPGRMIDEFESTASVSIPPQATDAKTLERLSERSYVRDWHRLGL
TNDASFNSKTQKHDLFRITSVNAGYLMCRSYPALLVVPAAIEDNSLRRICQCYRHNRFPV
VTWRHPRTKALLVRAARSYGKSVMGMLKGHPTATVATSDTASSIEQEKYLMELVAATPLS
VVRQGGTWGMSDSNLSIDSLVLAADDHLQTSLTTPESNRRNRRQSSSQASLASVNAGTRP
LQRLSGDSDSGTDSVQIFQRSPLYILGEKTQTKGVKTESNLKTDFIPLDYYDIRSTKAAF
KKIMRACIPSSVSPEPEQTFLKLVESSEWLLQIKSIMQISGTVVDLIDMQGSSVLLSLED
GWDITSQISSVAQLCLDPYYRTIDGFRVLIEKEWLAFGYRFSHRSNLSTNSPASGFAPTF
IQFLDVVHQIQKQFPLAFEFNDFYLRFLAYHSVSCRFRTFLLDCECERVECGITAVEDKR
GSLPTHHKGVDTCGSDDESIYPGGRLAGTSQGPNLGQSIFDYIEKQHMRLPIFYNFMYTP
DNENSVLRPSSHIPKLEIWGYYLNEELAHGPPYDLEIVQMDYLQDDETEPNEVGMKSLRK
TVIAGYDTVEKNVPEAFSQVLEEIYRLETELGHLPQKWKVLWDKLEIPSTDSLVRHSSFN
TQLVRYHGRLLHKRSTLEILLRGKIEGATEMSYAYSHPHRFEKYNYTTPTSCDACPNVFW
GPFKTGVRCVDCGYSCHEKCAENVPKNCTKYKAIEGNQTQTLTRSGHTNSVNSNVTTLQA
SSHQYYEQFSSNVAENRTHEGYLYKRGALLKGWKQRWFVLDSIKHQLRYYDAVEDSHCKG
YIDLGEVVSVISATPGPGTPKKADEKAFFDLRTCRRTYNFCANDASTAQEWIDKIQACLQ
Download sequence
Identical sequences E0V997
XP_002422691.1.24195 vb|PHUM006440-PA|EEB09953.1|SET-binding 121224.XP_002422691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]