SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM055910-PA|EEB10665.1|hypothetical from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM055910-PA|EEB10665.1|hypothetical
Domain Number 1 Region: 9-94
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000888
Family cAMP-binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM055910-PA|EEB10665.1|hypothetical
Sequence length 217
Comment protein Phum_PHUM055910|DS235023.1:466181:467474:-1|gene:PHUM055910
Sequence
MSEKKILTIENEEIKRALSLFPYFDTWDDNVIVKCCQVSAIIEFPPDKIIKDANSSNAQM
TFFILEGTSKIIYKLQVLKKKDSFGEYSSILLNTNEITGEEETNLMISGTNSFENEKKPL
NLKNEGEKTNEECREKLEKIRKKPNKTILDLKKEKNVETIFMEVAFFRKGGCFGLGENWI
KMKRKLSEKATLIKNIPNYTLDADVPFSLRLMEIPIE
Download sequence
Identical sequences E0VBA9
121224.XP_002423403 vb|PHUM055910-PA|EEB10665.1|hypothetical XP_002423403.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]