SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM108410-PA|EEB11363.1|toll from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM108410-PA|EEB11363.1|toll
Domain Number 1 Region: 84-213,245-454
Classification Level Classification E-value
Superfamily L domain-like 1.12e-44
Family Ngr ectodomain-like 0.034
Further Details:      
 
Domain Number 2 Region: 438-739
Classification Level Classification E-value
Superfamily L domain-like 2.21e-42
Family Internalin LRR domain 0.051
Further Details:      
 
Domain Number 3 Region: 1079-1226
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.4e-39
Family Toll/Interleukin receptor TIR domain 0.00012
Further Details:      
 
Domain Number 4 Region: 833-1009
Classification Level Classification E-value
Superfamily L domain-like 3.15e-29
Family Ngr ectodomain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM108410-PA|EEB11363.1|toll
Sequence length 1297
Comment putative|DS235072.1:590236:594129:-1|gene:PHUM108410
Sequence
MVEKESSSSLSSSKMMIFLIFCFICGIQCASEQVQSANSQSPPILRYEAPDDCQWWIREG
PDEVALICRLQTINSEFESTNFSVIPSEHTTSLRIQCNMELFSKSSLDDRSFAHLTKLRE
LVLDHCKLAKWPSGTLIGLGDLRNLSVRTHNTDWPELSMEISPESFLTVRQLERLDLSFN
NIWSFPESIFCPLTNLVTLNVSQNRLQDVGDLGFREKPPPPQSLISSRDDINDGDSVPTG
GIAPCTLDIQVLDVSWNHFVLIPSSGFSALRRLKELYIHDNEITMVAEKALAGLKNLEIL
DLSNNKIVALPPELFQDAAEGIKEIYLQNNSISILASGLFSNLKHLLALDLSKNHLTSVW
ITPLTFSGLIRLVLLNLGYNNISKLDPYLFNDLYTLQILNLEHNLIETLPLGTFAPMKNL
HTLILSYNKIRSLDAFSLNNLYVLSLLSLDNNLIENIHVDAFRNLSSLQDLNLNGNGLTA
VPAALQNMRLLRTVDLGENSISNIVEPGFAGMNNLYGLRLIGNQLTNITKKSFSNLPELQ
ILNLARNKIKRVEKGAFNDNLHLQAIRLDANLLTDIDDLFVGIQNLLWLNISDNKLESFD
YSLVPRTLQWLDLHKNFIKELGNHYSVDGKLKIQTLDASFNKLTTITAASIPNSVELLFL
NDNLIKHVEPHTFLKKVNLTRVDLYANQIVSMELNALRLTPVDPERALPEFYVGGNPFQC
DCTMEWLQRINNLDHLRQHPRVMDLEGIYCKLLYNRDKMYVSLVDVESSQFLCPYKFHCF
TLCHCCDFDACDCKMTCPSNCTCYHDQSWSSNIVECSAAGYTNMPDRIPMDATEVYIDGN
NLVELSSHAFIGRKNLRVLYANNSNIAAIYNHTFSGLKRLAVLHLENNAIKELSGFEFTS
LENLKELYLQGNEIHYINNRTFSELKQVQVIRLDSNKLRTFQVWDFTYNPYLVEIALSDN
QWSCNCQYLQQFRNWLQPNYAKVVDANKIICIFNNVTNLLGPPVADFNSTTCSAYTGDSR
AVIENPVIHDYLPLLLATLCTFLVSITIVCSVFYFRRELRVWIYSKCGLRMCYKTTAFEE
EQDRDRLFDAYVSYSVKDESFVNQVLAPGLEQTDPRYRLCLHYRDFNVTAYIADTIIEAV
ESSKRTIVILSKNFLHSEWCRFEFKSALHEVLKDRRRRLIVITLGEVPQRDLDPDLRLYL
KTNTCIEWGDRLFWQKLKFAMPDARRNNCTSSRHVRPHVNVNLYSTASTPNSYDHRSSSG
QRPSGKLLPPPLIHHQNNLQNAANQQQNCRLPQPLWA
Download sequence
Identical sequences E0VDA7
vb|PHUM108410-PA|EEB11363.1|toll 121224.XP_002424101 XP_002424101.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]