SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM122670-PA|EEB11505.1|predicted from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM122670-PA|EEB11505.1|predicted
Domain Number 1 Region: 470-600
Classification Level Classification E-value
Superfamily PH domain-like 8.2e-30
Family Phosphotyrosine-binding domain (PTB) 0.00016
Further Details:      
 
Domain Number 2 Region: 286-421
Classification Level Classification E-value
Superfamily PH domain-like 2.21e-29
Family Phosphotyrosine-binding domain (PTB) 0.0096
Further Details:      
 
Domain Number 3 Region: 193-217
Classification Level Classification E-value
Superfamily WW domain 0.000000000352
Family WW domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM122670-PA|EEB11505.1|predicted
Sequence length 646
Comment protein|DS235083.1:88001:93755:-1|gene:PHUM122670
Sequence
MFYENPNYHLDPARLDDALNSNLVPNVEDDLYEEIINELDAVCNLPNRGRPGSGCEGRKS
YASLDVTSMGVDVNTGPVTNLDSNKIECNNRSFDSVKDTSLDNSFNYNNLNMGRRPNDLN
AIVRTKPDLIEDAEYRRNKDISQINSLQNSKIDLEDVSNLHNQLTDDLFAVPVKRASQSP
TTDTQDTPDKDRLPPGWEKHEDNDGPYYWHIKSGTIQREPPEECKEISTIVQQFLKDTED
LNSSTVINCVTRSNTSSALESINKKEDLAYKRRSYPARVESSDSKQKPIRFAVRSLGWVE
IAEEDLTPERSSKAVNKCIVDLSLGRNDLLDVVGRWGDGKDLFMDLDEGSLKLMDPEKLT
VLNSQPIHTIRVWGVGRDNGRDFAYVARDKVTRRHMCHVFRCDISARTIANTLRDICKKI
MIERSLQQNLAKPVDINNCGRQGLAVRPTNLPTENRRHQRNGGGLSLGHQSFPTPMEEPK
KILKAQYLGSCQVNKATGMDILNEAIDQLSHTPEDTWINVSIAVAPSMISISPCGDENSV
ISECRVRYLSFLGIGQNVKLCGFIMHTAQDLFIAHVFHCEPSSGALCKTIEAACKLRYQK
CLDAHPQGIPRSQSGSQTPGKSIGAALKSFVGSLTGRKARGGSESS
Download sequence
Identical sequences E0VDP9
vb|PHUM122670-PA|EEB11505.1|predicted 121224.XP_002424243 XP_002424243.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]