SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM125270-PA|EEB11546.1|predicted from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM125270-PA|EEB11546.1|predicted
Domain Number 1 Region: 194-427
Classification Level Classification E-value
Superfamily PH domain-like 7.99e-72
Family SSRP1-like 0.0000054
Further Details:      
 
Domain Number 2 Region: 535-614
Classification Level Classification E-value
Superfamily HMG-box 2.23e-21
Family HMG-box 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM125270-PA|EEB11546.1|predicted
Sequence length 768
Comment protein|DS235088.1:134224:137687:1|gene:PHUM125270
Sequence
MTDVLEYNDISAEIKGAMTPGRLKLTDQFVIFKNYKTGKVEQIEKSDIETVHWLKFVGTF
GIRFFLKNGTLHRFKGFKEAEQNKLANFFLSKYKKEMNEKELSLKGWNWGTAKFSGSLLN
FEVSNHTAFEIPLNYVSQCTTGKNEVTIEFHQNDDAPVNLMEMRFHIPSSESQGEDPVDA
FHQNVMSKASVINVSGDALAIFREIQCLTPRGRYDIKVFSSFFQLHGKTFDYKIPASTVL
RLFLLPHHDKRQIFFVVSLDPPIKQGQTRYHFLVCLFPQGEDEISIELPYSEEEVKQKFD
GKIEKEMKGQTYEVLATLMKSIVGRKLTYPSFTGKSDTPAIACSYKAAAGYLYPMDRGFI
YVHKPPFYIRFEEVASVNFARSGGSTRSFDFEVELKNGVVHTFSSIEKDEYEKMYDFIVL
KKLIVKNRGKADKPNYNDDFVDSDQENDAYLVRVKREAEERDENGDGASNDEESTDEDFN
PNQEESDVAEEYDSNAPTTESDEEGGSDASGKEKKEKKHKKAKTISEKPRKKKKEKKIKN
SNAPKRPPSAYFIWMNENRDKLKEEYPNLQMTELAKKAGEVWRELKDKTKWNEKAKKAKA
EYEVALKKFKESGGGVEEEKEVKEVKEGKEGKEGKEGKVVKKSVKPPPSNSNKSFSGSGF
KSKEYLSDSDSDSSNGEASKKKVSKEESEGDKSKKSSEKTKNDKDKSSEKSKKRKASDNE
SSNKKKKTESESQKSNEKDQSDEDENFPEEPEESTPPTTEESEESGSD
Download sequence
Identical sequences E0VDU0
121224.XP_002424284 XP_002424284.1.24195 vb|PHUM125270-PA|EEB11546.1|predicted

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]