SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM135890-PA|EEB11809.1|Ryanodine from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM135890-PA|EEB11809.1|Ryanodine
Domain Number 1 Region: 215-392
Classification Level Classification E-value
Superfamily MIR domain 8.37e-41
Family MIR domain 0.0029
Further Details:      
 
Domain Number 2 Region: 1079-1209
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-21
Family SPRY domain 0.03
Further Details:      
 
Domain Number 3 Region: 663-798
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000411
Family SPRY domain 0.036
Further Details:      
 
Domain Number 4 Region: 4152-4209
Classification Level Classification E-value
Superfamily EF-hand 0.00000000202
Family Polcalcin 0.042
Further Details:      
 
Domain Number 5 Region: 98-181
Classification Level Classification E-value
Superfamily MIR domain 0.00000118
Family MIR domain 0.024
Further Details:      
 
Domain Number 6 Region: 2227-2309
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000118
Family IP3 receptor type 1 binding core, domain 2 0.021
Further Details:      
 
Weak hits

Sequence:  vb|PHUM135890-PA|EEB11809.1|Ryanodine
Domain Number - Region: 3038-3212,3250-3277,3306-3414
Classification Level Classification E-value
Superfamily ARM repeat 0.000297
Family MIF4G domain-like 0.066
Further Details:      
 
Domain Number - Region: 2271-2312,2370-2449,2625-2770
Classification Level Classification E-value
Superfamily ARM repeat 0.0096
Family HEAT repeat 0.051
Further Details:      
 
Domain Number - Region: 464-628
Classification Level Classification E-value
Superfamily ARM repeat 0.0132
Family MIF4G domain-like 0.089
Further Details:      
 
Domain Number - Region: 1511-1635
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0372
Family SPRY domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM135890-PA|EEB11809.1|Ryanodine
Sequence length 5058
Comment receptor, putative|DS235093.1:31001:54243:-1|gene:PHUM135890
Sequence
MAEAEGGSEQDDVSFLRTEDMVCLSCTATGERVCLAAEGFGNRHCFLENIADKNIPPDLS
QCVFVIEQALSVRALQELVTAAGSESGKGTGSGHRTLLYGNAILLRHQNSDMYLACLSTC
SSQDKLSFDVGLQDHSLGEACWWTVHPASKQRSEGEKVRVGDDLILVSVATERYLHTTKE
NDLSIVNASFHVTHWSVQPYGTGVSRMKYVGYVFGGDVLRFFHGGDECLTIPSTWSEEPG
QNMVVYEGGSVMSQARSLWRLELARTKWSGGFINWYHPMRIRHITTGRYLGVNENNELYL
VNREEATTSLSTFCLRQEKDDQKVVLEDKDLEVIGAPIIKYGDSTVIMQHSETGLWVSYK
SFETKKKGVGKVEEKQAILHEEGKMDDGLDFSRSQEEESRTARVIRKCSSLFTGSIKSLE
NIQATRRTSSFFATVNLTEIVMCLEDLINYFEQPEEEMEHEEKQNKLKALRNRQDLFQEE
GILNLILEAIDKINIITGQGFLVALPGEIGQNWEAISSYLYQLLAAIIKGNHTNCKEFAN
TNRLNWLFSRLGSQASGEGTGMLDVLHCVLIDSPEALNMMKDEHIKVIISLLEKHGRDPK
VLDVLCSLCVGNGVAVRSSQNNICDFLLPGKNLLLQTQLVDHVASVRPNIFVGRVENSAV
YQKWYFEVTLDHIEQTTHLKPHLRIGWANTSGYVPYPGGGEKWGGNGVGDDLYSYGFDGA
NLWTGGRKTEVVPEATEPYIKKGDIIGVALDLNVPIITFTMNGVQINATFKDFNLDGMFF
PVISCSSKLSCRFLLGGDHGKLKYIPPEEFSPLIECLMPQQVLSIDPCFYFGNLNKNVLA
GPWLVEGDTAFVPNPVDTSTITLPSYIENIRDKLAENIHEMWAMNKIEAGWIFGEIRDDV
RKIHPCLTQFEKLPPAEKRYDSQLAIQTLKTILALGYYITMDKPPSRIKQIRLPNETFLQ
PNGYKPAPLDLSAVALSIKMEELVDHLAENTHNLWAKERIQQGWTYGLNEDPDLLRSPHL
VPYIKVDDAIKKANRDTASETVRTLLVYGYNLDPPTGEQQEALLAEANKSREQDFRTYRV
EKNYAVSNGKWYFEFEILSSGPMRVGWARADCPPGNKLGSDEYTWAFDGFNEEKVFCGSG
ESFGKQWKIGDVVGVFLDLLDRTISFSLNGELLMDALGGETTFAEVQGDSFIPACTLGIG
QKARLTFGQDVNTLQYFSNCGLQEGYEPFCVNMNRPVTYWYTKDQPIFENTDESSDSMID
VLRIPAGSDSPPCLKISHNMFETMEKANWEFLRLSLPVICQSTLIDEEEKNKRWQEIKSR
QRRLLTESEHPTPAHIEQIMKSGFSINDIKGLARGYSEDAVEADEMLLNRPDIQNQGHSP
KPSRKGSLTRFEGRNHGGTMGSRKNNRSNSEIDINKLENEEKDKKTRGRSPFRFFSRRKD
GDRQRKNRTPEPGSPDYDHLSPPQIRISKADGKDSMAGDRNVNLQDKMSPGVDSVGNEPF
DVECLKLINEYFYGVRIFPGQDPSHVYVGWVTTQYHYFSNEFNQTKVRKASITKIDDFNN
VKERIDRQSCYMVKASELYNEVSSDTSGKGASQGMFIGCFVDTATGFITYTCEGKETSHK
YKMEPETKLFPAIFVEATSKEILQVELGRTSSTLPLSAAVLMNSERHITPQFPPRLKVQC
LKPNQWARVPNQSLQVHALKLSDIRGWSMLCEDPISMLAVHIPEEDRCIDVLELIEMERL
LSFHAHTLTLYSALCYQSNYRAAHILCQHVDERQLLYAIKSAYMSGPLRRGFYDLLISLH
LESHATTMEVSKNEYVIPLSQELKELYRDSDMYHSLSSLNMESVRPKMKMTDSSEQVENI
RELYSPYFPLNVVRDFVMQALEEAVEVNQVHNRDPIGGSNENLFLPLLKLVDRLLLVEVL
RDEDLKKLLIMMDPETWDETFDKSGKDEHRKGLLHMKMAEGAKLQMCYVLHHFGDIQLRH
RVESLIAFSAEFVGELQQDQLRRYTEIKQSDLPSAIAAKKTREFRCPPREQMNAILGFKN
LEDDDVENCPCGIELREKLNVFHSKLMSQVSLTALQEPLESEDEETSDKPTTMKKLYSLI
HAVKELEETPEPSEEPQKKSPEAIFRKVLISTIVRWAEESQIETSKLVREMFSLLVRQYD
SVGELIKALGKTYVTNAKTRDDAALMWVGLSQIRSLLPVQMSQEEEGLLRERLWKLVNNH
TFFQHPDLIRVLRIHENVMAVMMNTLGRRAQTQSDTPQTTDQGEAVPKEKDTSHEMVVAC
CRFLCYFCRTSRQNQKAMFDHLAFLLENSNILLSRPSLRGSTPLDVAYSSVMENTELALA
LREHYLEKIAVYLSRCGLQSNSDLVEKGYPDLGWDPVEGERYLDFLRFCVWVNGESVEEN
ANLVIRLLIRRPECLGPALRGEGEGLLRAIVDANQMSEKISDRRKLMDEAEGTMAMSDFQ
HPLPESDEDEDYIDTGAAILAFYCTLVDLLGRCAPDSTVIALNKNESIRARAILRSLVPL
EDLQGVLALRFTLQQPAAGEERAKSDMPSGLIPGHKQSIVMFLERVYGIETQELFFRLLE
DAFLPDLRCATMLDRSDGSESEMALAMNRYMGNSVLPLLIKHAKFYSEADNYASLLDATL
HTVYRLSKNRMLTKGQRESVSDFLVALTSQMQPSMLLKLLRKLTVDVSNLSEYTTVALRL
LTLHYDRCAKYYGSSSGQQSLYGASSDEEKRLTMVLFSNIFDSLSKMDYDPDLFGKALPC
LAAIGCALPPDYTLSKTFDDEIYERGGAGERGSYTPQPINTASIVLNTDLNSIVQKFSEH
YHDAWASRKLENGWTYGETWSDTNKTHPRLKPYSMLNDYEKERYKEPVRESLKALLAIGW
NVEHTEVDIPSSHRASMRRQSKPTSAESSTPFNYHPHPVDMTNLTLNKEMQNMAERLAEN
AHDIWAKKKKEELTACGGVVHPQLVPYDLLTDKEKRKDRERSQEFLKYLQYQGYKLHRPY
KGGETEQAAALSSVENRFAYSLLEKLIQYTDKAAINMKLLKPSSTFSRRTSFKTCSRDIK
FFSKVVLPLIEKYFNTHKNYFIAVATASNNVGAASLKEKEMVASLFCKLANLLRIRLTSF
GSDVRITVRCLQVLVKGVDAKSLVKNCPEFIRTSMLTFFNNTADDLSHTILNLHEGKYSH
LRGTHLKTCTSLTYVYSVVLPVLTSMFDHLASCEYGSDLLLDEIQVAAYKILGSLYTLGI
DGTLHGDRKYLKTEIDRHRPALGNCLGAFSSTFPVAFLEPHLNKHNQYSLLNRIADHSLE
AQDVMARMEQSMPSLEAILSDVDAFVESDKTHTDSPHIIDVVLPLLCSYLPFWWSQGPDN
VNPQGGNHVTMITAEHMNQLLKSVLNLIKKNIGNENAPWMTRIATYTQQIIINSSEELLK
DPFLPLAERVRKRTENMFHKEESLRGFIKSSSDDTSQVEAQIQEDWQLLVRDIYAFYPLL
IKYVDLQRNHWLRNNISEAEDLYKHVAEIFNMWSKSQYFLKEEQNFIAANEIDNMILIMP
TATRRTAVSSESGTPSSGNKKKKKKHREKKRDKDKEIQASLMVACLKRLLPVGLNLFAGR
EQELVQHCKDRYLKKLPENEISDFAKTQLTLPDKIDPADEMSWQHYLYSKLGSKKEVAVE
VKDKDKQIEELVCRIVAMAKVLYGLHMIDHPQQQGKAVYRSVVSTQRKRAVLSCFRQASL
HSLPRHRSINIFVKTYFEQWLQDENTGQEVMIEDLTQSFEDAELKKNDKNEDEAKPDPLT
QLVTTFCRGAMTERSGALQEDPLYMSYADIASKSCGEEEEEGGDEEEEGGGSSIHEQEME
KQKLLFHQARLANRGVAEMILLHISACKGIPSDMVMKTLQLGISILRGGNIEIQMGMLNH
LKEKKDVGFFTSIAGLMNSCSVLDLDAFERNTKAEGLGVGSEGAAGEKNMHDADFICALF
RFIQLTCEGHNLEWQNYLRTQAGNTTTVNVVICTVDYLLRLQESIMDFYWHYSSKELIDP
AGKANFFKAIGVASQVFNTLSEVIQGPCTQNQQALAHSRLWDAVGGFFFLFSHMQEKLSK
HSSQVDLLKELLNLQKDMITMMLSMLEGNVVNGTIGKQMVDTLVESASNVELILKYFDMF
LKLKVLTETPSFKEIDYNNDGWITPKDFKEKMEQQKSYAPEEIEFMLMCCETNHDGKIDY
VTFTEKFYEPAKENGFNLAVMLTNLSEHMPNEPRLARFLETAGSVLSYFEPFLGRIEILG
GSKRIERVYFEIQESNIEQWEKPQIKESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEM
THASALMDVEDSSGSGKAREAAYRYVADDEEERLAKDPVKRSIVYVKSGISNAFQFFSPS
NIKRNISDFQQKPPLEQIKCFLKFFFYIFYYSGYGFASVIKYFLGMIMNLMRGPKEEATE
EVVEEKEDFGPLKPLGVPSLTGEETGSLAISHKDDNNKSDNLSSTSPSTGEENDENTTEE
GQDSPKEEQLTLQDLLGGDIAKKEAVLTAEAQSQQQAVMAAVESEAKQNATVGEPAAVSQ
IDFNAYGHRAVSFLARNFYNLKYVALVLAFCINFILLLYKVTNVEGENDSKSSNEAASSL
NDVFSGEKGDNFGSEEGGNESGEDEGEDIEIVHVSEDYFYMAHVLRLMAMLHSLVSLAML
IAYYHLKVPLAIFKREKEIARRLEFDGLYIAEQPEDDDIKSHWDKLVISAKSFPVNYWDK
FVKKKVRQKYSETYDFDSISNLLGMERTSFSAQENGKTGSGIIHFVMNIDWRYQVWKAGV
TITDHAFLYSLWYFVFSVFGNFNNFFFAAHLLDVAVGFKTLRTILQSVTHNGKQLILTVM
LLTIIVYIYTVIAFNFFRKFYVQEEDDEVDKKCHNMLTCFVFHLYKGVRAGGGIGDEIEP
PDGDEYEVYRILFDITFFFFVIVILLAIIQGLIIDAFGELRDQLESVKEDMESNCFICGI
GKDYFDKVPHGFDTHVAQEHNLANYMFFLMHLINKPDTEYTGQETYVWNMYQQRCWDFFP
VGDCFRKQYEDELGGGNN
Download sequence
Identical sequences E0VEK3
121224.XP_002424547 vb|PHUM135890-PA|EEB11809.1|Ryanodine XP_002424547.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]