SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM140130-PA|EEB11896.1|hypothetical from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM140130-PA|EEB11896.1|hypothetical
Domain Number 1 Region: 918-1093
Classification Level Classification E-value
Superfamily PH domain-like 8.22e-23
Family Pleckstrin-homology domain (PH domain) 0.0034
Further Details:      
 
Domain Number 2 Region: 5-78
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.57e-18
Family SAM (sterile alpha motif) domain 0.0064
Further Details:      
 
Domain Number 3 Region: 207-288
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000223
Family PDZ domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM140130-PA|EEB11896.1|hypothetical
Sequence length 1571
Comment protein Phum_PHUM140130|DS235098.1:29865:35727:1|gene:PHUM140130
Sequence
MAYVSVAEWRPEQVTEWLKGLDNCIVSYIHWFSNNEVNGQQLLNLTPDDLTHLGVFKLGH
QELILEAVQHLRNFHYELDRENLQLLALKLSCAAHSLYSEIRDQAESSSVPTQIMADVAN
VIHHVKPLVSWLDRPPFAGEIQYTEYKSQLLNLSLEMATSAQRDRFAERPVAEIRNCSFK
LANLADSIIQNITNPMILQPATLDLATIKKKAGEELDFFLVPSFHGIHQIGDMKLSSPAH
QSGKIQQGDEIVQVNYQTVVGWSRKKVLALFEESPNDLLLTLKRRPRHVKMYGQIYMKPY
RLPSRKRALPFSRWNDNLPSPRPELLTIPDFDTTRNLSKKVENNESLSLEPSGTSSSSDE
EFGQTSDTQSPLSMRLFLTKPRSSIQRRFTLSGPPRPSAQSEQINNSSAQNVGSKNGNIN
EMFQLRDKSASLGNSIASASSRSTSCVPFTKTRIGSVKFDLSKFDNEIKNDKIICTEKEK
NSQVAVVVAAVPDVDGSTTVETKSENKKNLTNNDSDEKNCVNLTSQTTNLSITELNKIKR
NAFFNNMECCSNTQSNETIDKLVREGSSDRVKRVIENFKSEIINKSKKDSTEIEIVKSPG
KVMELVENFEKKENMNPPTVRNKINLNLMGKSIREKNNLNKICDISVCNNVNNENINEMK
RKSDDDSVKEIFSAVENVKRLNLNDKSSSDEEPFISTGKKNFQDVVESKTNNSNNNNKFY
NEINENNNNNNFDKTLFKDKNDISMISSGESLNITDETKIINSEESNQNECKMESNKEED
QMSAEALITTTTNNNEKESFKPIPAQRKSKMTGDSNKNLYPLPPKPRTKLPNSSSSDDNN
ALYHGVVNKNNEKPPEPPPRPDSTFLKLPSIKSGNFIEIVNKKPGKDSTTVEKGLTISAP
LITMMPETPSLPLNLQPVSPMPSSVPSERKKTSKSSSSFGSCSNEKTKNSVSTLESLKAM
LTLGRRATNVNSPRSMRKKNAMLAKKRNVSVKEITPNENCGYLYYRNRRGLAVASWTKFF
FVLQESNFYGFKCRESTKADLFIHLPGFTCTLAEEVKSKDYSFKIYHTGTVFYFAANSQE
DLQQWLDSINVAISNQDERGGGGVVVVPDVVNFSQTDSDDDSDTEPEPETCFPTSPKMKK
VLGSSSLPKPARSHQNLASDSKKSNEMQRRFGSLKKLSTRKNSNASETSSSDQGGASLDR
KYLRFLGQRNSPTPVPTTGFRSYRRINPTPVLPTKTGKSTAKVKGLENNVETSTIQNLGN
VRDPPKLSRKPLHSSNPSLAHPEMADYRVTQERLTEFRRLRNQGGNVGDSNRFLTLEQFM
QTMQEDNFRTNRNRAQEINGFITLEQFLLRQEEERQRSIVKPQERPSTSNDLGNGEPSTT
VEYDEEERRSRPEMNNFNRDVSVQNGPTTSNIRINRPKIAEIDEPSGESKNKDSSNVIEV
SKNPTAATAAAAAAYNSPPNCGVSSSSSSSSSSSSTSTSSSSSFSSVSSTTASRNDAMKK
AFEMTLDNNNSNTSSNVSHNVQSGQVSGQGNKRITYQGIEYPPAFEPETYTLQHMLKNRQ
KNYQDSKKKKQ
Download sequence
Identical sequences E0VEU0
121224.XP_002424634 vb|PHUM140130-PA|EEB11896.1|hypothetical XP_002424634.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]