SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM151040-PA|EEB12042.1|dedicator from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM151040-PA|EEB12042.1|dedicator
Domain Number 1 Region: 160-284
Classification Level Classification E-value
Superfamily PH domain-like 1.37e-22
Family Pleckstrin-homology domain (PH domain) 0.00086
Further Details:      
 
Weak hits

Sequence:  vb|PHUM151040-PA|EEB12042.1|dedicator
Domain Number - Region: 672-735
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00483
Family PLC-like (P variant) 0.082
Further Details:      
 
Domain Number - Region: 1432-1540
Classification Level Classification E-value
Superfamily ARM repeat 0.0104
Family HspBP1 domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM151040-PA|EEB12042.1|dedicator
Sequence length 2028
Comment of cytokinesis protein, putative|DS235107.1:87948:96192:-1|gene:PHUM151040
Sequence
MSERKFSKAVGKPGMAAQVRETVSQVVKDSAQVTQVKSIEPIDYEKFVFKNKTLLQNDPQ
RELLLYPSDDVSQVVLPRRYRTVAQTFPSSSEISQCNLFVKECLKSYSSNWNLIHYKYSA
YSGTYLDLPKVLKSEDLKEEVYEVDTEVDQVNEESFTRVDGITKEGYLLKGPDVGGDRIF
VNLGSKSYKRRYCYLRHHVDGTYYLELHKDEKKGEPKATIDMDFCNEVVKNSKKGRYCFE
LQMSGHKTFTFAAENEIDLQDWIIKLNLVIQQNKAQEEKRCASLDRACNTPPPSPQPCQV
YGTLKGLEESMNPQLIKYGRETDASIALSRKENRRRLFSIYPYMPHVKVGGSLGSEPNSE
PYREHFGQRILIRCESIKFKLQAASENEQEGSYQVEPYFTSLALFDVRQNRKLTENFHFD
VNHSKVREMLPNDENEENTIKKSLSSEIANLPDEWIIYPKRALFSVSNPHPDIYLVLRID
KVLQGAINTASEPYIRSAKDSRLGSKVQKSAKAFCQRLGKYRMPFAWTARPLFRLYSNDL
DNSDFPAIYRQEPNRLKDEEILKFLSEYRKSDKLSKLTVIPGWAKIKIEELTEIPENTLT
SSLVPLKPFPIPPSNEPTFEITEFEGSSENDVHPYTVFNNHLYVYPLSLNFDTQKNFTRA
RNIACCIELRDSDSENAKPLCCIYGRPGSVLLGKQIITSVLHHNTSPVWYEEVKLRLPIH
LKPEHHLLFTFYHVSCEINKKKENGVESCVGYAWLPLLHKGRLCVEEQTLAVALHLPPGY
LSIQPLGLGRGNAGPDITWIDGQKQIFTVGFQLVSTVITRDLHLHNLFCHIEKLIDKQLA
VIPSESETCKIIKASHAIQLTTAIAFLPTILNQLFHLLLIASTKEIGLNVIRVLIHIIHL
IQEAGKKDVLHPYIKFVFVTPTLPSLKTTVHEELSKLLPTLLSPSNTDFLVVNKFMNHSS
FFFQIMIKSMVQYLLNTGRIKMHRHERFSAEYMEKIDELLKILVPYVITKHREMPLETLE
LNKSLAQFLKKCLTVMDRGYIFRLINYYMEHFKESDSRTLHEYKFSFLQIICSHEHYVAF
NLPVLNLKLRPSKSTDSPVNNFGLTDEFRKHHYLVGLLLQETTKSLNQVSQIRKFAISTF
RDILAKHELDDRYQNKGQLARIASLYLPWLTVVLDNFNRLCTPQNDVIHNILDSRHSRMS
SSSSLLQCSSASNSLKPFQRLAVDQNSRTSIYLKDSHLFAVIAGQSNMINGTSTASLGSD
ESYDGLSTASQETTIVRDSRDELDFKTHTRSFSGITTASQQPRCDKFQNSEIKDILLCFL
FVIKYLGEESLISWWQQNEYNVVLYFFSVIEICLHQFKYVGKKQIVGKQAQGKPMKAMTL
PARMQPPDFSKTDGTNLPIPSGTSSVGRDGQLALDNDASKVYQALLEANMATEVGLIVLD
TLGLYCVHFKENLMYSQGDNAIMRKIFDIYLFFLQVGQSETLFRHVFAALRAFINNFSDV
LFEGNAELCGRLCYELLKCCNSKLSTIRQESCVILYLLMRSNFEFTKRKGLTRVHLQVII
SVSQMLGNVVGLNNARFQESLSLINNYAKSDKVMKDTGLKFEVKDLTKRIRTVLMATAQM
RENHQDPELLVDLQHSLANSYASTPELRLTWLQTMTRNHHYNGNFSEATCCQLHIAAMIA
EYLKLKKVQIWGAEAFDELSSNILVDETGLKLDSGIQDVQFTEQILLEQLENCVPLIEKA
ERYELLNPLFKLIIPIYEKRRNYQALAQCHQNLADAFAKISEINKTGKRLLGRYYRIAFY
GQICFDDNNEETESCQKNGIEYIYKEPKVTSLSEVSEKLYKLYGEKYGRDAVKIIMDSNP
VDPSKLDQKLVHIQVTSVTPYFTKKELEVRQTEFETTHDINCFMFDTPFTKDGKVRGTPE
EQWKRRTILKTKHSFPYVKKRIEVINRRIEEHSPIEVALDEMRLRVNELEEVVFTRPTDL
KKLQLRLQGSICVQVNAGPMAYANAFLDPSRVKLYSESKVEELKDIFQ
Download sequence
Identical sequences E0VF86
vb|PHUM151040-PA|EEB12042.1|dedicator 121224.XP_002424780 XP_002424780.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]