SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM154970-PA|EEB12078.1|hypothetical from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM154970-PA|EEB12078.1|hypothetical
Domain Number 1 Region: 9-160
Classification Level Classification E-value
Superfamily RUN domain-like 7.72e-18
Family RUN domain 0.0049
Further Details:      
 
Domain Number 2 Region: 501-566,615-650
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000256
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM154970-PA|EEB12078.1|hypothetical
Sequence length 775
Comment protein Phum_PHUM154970|DS235111.1:30758:33722:1|gene:PHUM154970
Sequence
MEDAYSKNSHRERILWDLKSIIKQIYHESAKHELSPENRTYICLKLVKNLDETLCYGLKQ
LYLGYWKPICEVLHPQTLQAVEQLPVSNQSESNSLMKGRAWIALSLKDDSFINYIQCFIN
EGCLDRFYEDWSILRFSDACNSFLSILSGLENVKFNFDVDYVNKPLANCNLQLKLPGNEE
CKFIPLNLKGSKGSIDLGTSSSSLTSPVDSGVHTQDSSSDMEPFSNDKEFEIDLLNGNVP
PDTVLRRKHKKNAKRHVSFHEDIINKSSEKCRKLKWDSENLRYSWSGEEIDSSILKEKQF
IEMKPYDNNNRSTPLKELNMNERGTPEGEETPSEIERLKNKQPQKSVIVKRFLLSIKNQS
KLKQMSKVQISKNEVQLNPLMIKDMIRNQSVYKAYKLRDYLFIITDNSHAFSIYEYDNEL
HTFITGDGELTNEVLGKLEFLIRRNQLEFPQFYFLDYNDFKFVKNNFVEKLVVDKKDDIL
YCGAVHLDKENDLTNSILPNSKRGFLMYRFLQGGDGWIPGDFCLRNGVLYLFGDDTNLPK
LAINIATGCQSCNRTKNPDRPHTFQITLIDGKFENFNSLRENNVTKQKSSKSESRKIFSG
IRQRVNKMWSFGNSKNSSSIIEFAAANDYDLSEWFQMIIQASCEAHKENLLEGTLWLTQN
SLIITNEIWWLNSDLDIISCARLRDVAAFKIGECEKDFFTVIEFICMEANSTSGDWILYL
NSREELNKLTSKLKLLWKSREKFPCYELEKGILLNRCKKSQETISDNYWSLLLLQ
Download sequence
Identical sequences E0VFC2
vb|PHUM154970-PA|EEB12078.1|hypothetical XP_002424816.1.24195 121224.XP_002424816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]