SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM189850-PA|EEB12539.1|Rho from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM189850-PA|EEB12539.1|Rho
Domain Number 1 Region: 366-540
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.49e-44
Family BCR-homology GTPase activation domain (BH-domain) 0.00021
Further Details:      
 
Domain Number 2 Region: 87-185
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000297
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Weak hits

Sequence:  vb|PHUM189850-PA|EEB12539.1|Rho
Domain Number - Region: 198-277
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00186
Family Ras-binding domain, RBD 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM189850-PA|EEB12539.1|Rho
Sequence length 945
Comment GTPase regulating protein, putative|DS235150.1:284800:293065:1|gene:PHUM189850
Sequence
MYFKGFLYFVVQVVKKGQEESDLERIQDLFPGDALGLYDKDALTMRMKGLIRKRSTTASK
LQRALSAKRTEPEEQSLPKDGQDKRVFLLETPVQFTTGVQSQERHLFLFNDLLLVAKARS
GGNFKLKEKVRISEIWMTKCSMEDVIEVHKSQETSFVIGWPTTNVVATFSTQATRDLWWN
KLSEVVAIEREKEPKSTNIQVLYNDVSTGIEYVKTFSIGPHDTATRCIALALDHLEMRGL
NAAEFQLWAKTSRDEAPYPLIGHERPFAIKLSCLREGLSTEEGFDLDHCNNVHGPDMLTR
CQFILRNIQRPLECASAEGKKDRKKSRKSPMRIRHVFRRSVNKDDCVDHPYPGVLFGQPL
SKVTDGELPPPPVMSMFQQVFQKGPFTQGIFRKSANARLVRELRDKLDSGEDVQLDVVPV
LVTAALLKEFLRSLPEPLLGSTLYPLWLEALNCGNQSERLLRLKSLVEQLPKSNQILLAH
FLCVLHHIARKSSLNLMSAGNLGVCVGPSLLWTPCMTPAGSKAVPALVEALVTHCEVIIG
PHVPHLLGEPPERPQDSGAEESDSLHSGGLRRDDSSIDSLERELLDPPRKDKMSLSRDSG
LTMSDSQLYTPDEEESTSSSSCGSGRGVYSNTTTPTHANNYHPHNKVSPSYSVPGGNTNL
APSALTTTPNRKYVRVYRGWEERVQDCCRNRSNSIYSQTVRSGSGVINSNFQRQDWFRQR
SQLKRLNSGGIPTDSTGARSASQESLLGSHSKEPCETTTGRQMMCKERKFQHLPPVHLDP
LPDEKKSAERRGRLRQRELAHKTAAQRSKSLPPLEEHTRHDSVDQKWYSPPNGENWNRSG
YDETNYSCKVPDVVVTRTKKDGHSVHKSINSNRNHVRDDLKKLENTLPPLQKSRTIEIPP
PYRPPPTVGTTSLNTRAPITTYHLRKALSRRIIIDQDDHQEESYV
Download sequence
Identical sequences E0VGN3
XP_002425277.1.24195 121224.XP_002425277 vb|PHUM189850-PA|EEB12539.1|Rho

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]