SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM225060-PA|EEB13125.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM225060-PA|EEB13125.1|conserved
Domain Number 1 Region: 470-569
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000173
Family Pleckstrin-homology domain (PH domain) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM225060-PA|EEB13125.1|conserved
Sequence length 578
Comment hypothetical protein|DS235191.1:123448:126099:1|gene:PHUM225060
Sequence
MVYRFHDQVFNKMTPEKRARNLCVMKALSRDSMRLNKNKENENPLNNNTTPFNLKHSTPI
KYRKITDSNYPERISPVDINTTDSENFLEKKKKDPDEPKLVFAKIYELTPNGETNVIETT
TTTTTTTSRNDYSKSSEFEIIVPEKKLQNGELNSRKKESNWKSLNVLNDVAEYEFCKSLE
QSKLCLSTSNLLEEIEADLPSHYSLAKPLNHTFHSLESYRTVTRLARNDKNLTTIDYVET
DVDEGDEKVLLLKKLDFLEMEATIQKAKIRQAQKAMTLSKNKKSMDVEYFECEKTLLLSG
LRLNAALQEMERLKRSQGTANGCFKDNYGQVTIREIVFYVDDVTLNKDGKLYFDQPMKFQ
NLNKDFVINIQLYKRRGKEGKEPKKIFLMKKLKELAGNTLQKTITTSSVGEKHDFECVAS
TRLKLENVSNRKQDKCVLKFSEPPQHPVMRDALVLYLKTDFNVETKDAFGFLNVFNNSCW
QRWWFSQSGYYLNSWLYPEDEENNKVPVYSLHLPSCTEKVKIADLEVCIRPHSFVVVTGP
PNNKEEILFSAESNKDMIKWMNHLNLIIECVRLWKPNA
Download sequence
Identical sequences E0VIB9
121224.XP_002425863 vb|PHUM225060-PA|EEB13125.1|conserved XP_002425863.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]