SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM287180-PA|EEB14212.1|Spectrin from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM287180-PA|EEB14212.1|Spectrin
Domain Number 1 Region: 34-270
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.11e-86
Family Calponin-homology domain, CH-domain 0.00000381
Further Details:      
 
Domain Number 2 Region: 291-411
Classification Level Classification E-value
Superfamily Spectrin repeat 1.14e-34
Family Spectrin repeat 0.0000716
Further Details:      
 
Domain Number 3 Region: 629-747
Classification Level Classification E-value
Superfamily Spectrin repeat 5.16e-31
Family Spectrin repeat 0.0000957
Further Details:      
 
Domain Number 4 Region: 2187-2297
Classification Level Classification E-value
Superfamily PH domain-like 3.56e-29
Family Pleckstrin-homology domain (PH domain) 0.0000561
Further Details:      
 
Domain Number 5 Region: 1855-2006
Classification Level Classification E-value
Superfamily Spectrin repeat 5.23e-28
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 6 Region: 1215-1368
Classification Level Classification E-value
Superfamily Spectrin repeat 6.02e-28
Family Spectrin repeat 0.00077
Further Details:      
 
Domain Number 7 Region: 1427-1576
Classification Level Classification E-value
Superfamily Spectrin repeat 7.92e-27
Family Spectrin repeat 0.00036
Further Details:      
 
Domain Number 8 Region: 1745-1899
Classification Level Classification E-value
Superfamily Spectrin repeat 2.54e-26
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 9 Region: 1532-1674
Classification Level Classification E-value
Superfamily Spectrin repeat 6.28e-26
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 10 Region: 1131-1250
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-24
Family Spectrin repeat 0.00041
Further Details:      
 
Domain Number 11 Region: 1000-1119
Classification Level Classification E-value
Superfamily Spectrin repeat 3e-23
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 12 Region: 742-845
Classification Level Classification E-value
Superfamily Spectrin repeat 6.19e-23
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 13 Region: 375-520
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-22
Family Spectrin repeat 0.00034
Further Details:      
 
Domain Number 14 Region: 895-1011
Classification Level Classification E-value
Superfamily Spectrin repeat 3.02e-20
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 15 Region: 523-634
Classification Level Classification E-value
Superfamily Spectrin repeat 4.84e-18
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 16 Region: 1639-1742
Classification Level Classification E-value
Superfamily Spectrin repeat 7.34e-18
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 17 Region: 1987-2070
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000615
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 18 Region: 1377-1439
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000712
Family Spectrin repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM287180-PA|EEB14212.1|Spectrin
Sequence length 2332
Comment beta chain, putative|DS235271.1:1126302:1141016:-1|gene:PHUM287180
Sequence
MTTDISVVRWDQTLPQDLTQEIVEYDGGNSSSRLFERSRIKALADERESVQKKTFQKWVN
SHLVRVSCRIGDLYVDLRDGKMLLKLLEVLSGERLPRPTKGKMRIHCLENVDKALQFLRE
QRVHLENMGSHDIVDGNPRLSLGLIWTIILRFQIQDITIEETDNQETKSAKDALLLWCQI
KTAGYPNVNVRNFTTSWRDGLAFNAIIHKHRPELIQFEKLSKNNAIYNLNNAFNVAEDKL
GLTKLLDAEDVYVDQPDEKSIITYVVTYYHKFSKIKQDNVQGKRIGKVVRIAMDNEKMIH
EYETLTSDLLKWIEKTIAQLGDRQFANSLHGVQQQLLQFNSYRTVEKPPKFVEKGNLEVL
LFTLQSKMRANNQKPYTPREGKMISDINKAWERLEKAEHERELALREELIRQEKLEQLAA
RFNRKASMRETWLSENQRLVSQDNFGLDLGAVEAAAKKHEAIETDIFAYEERVQAVVAVS
QELEAENYYDINRINARKENVLRLWSYLLELLRARRSRLELSLQLQQNFQEMLYILDSME
ELKMRLLSDDFGKHLMGVEDLLQKHSLVEADINVLGERVKAVVLQSQRFLDQETLEGYKP
CDPTVIVDRVQQLEDAYGELVNLAVERRKRLEESRQLWQFYWDMADEENWIKEKEQIMMN
GDIGHDLTTINLLLSKHKALENEIASHEPQLMSVVSIGEELVNRDHFGATRVRDRLQEIL
GMWQHLSDLAALRRKRLEEAVDYHQFFADADDVDIWMLDTLRLVSSEDVGRDEANVQSLL
KKHNDVAEELKNYEATIAALKNQASQLGEHDKQSPEVLDRLSSIDHRYKELLELSKLRKQ
RLLDALSLYKLFSESDGDRMLLTMVPAKDIEDVEIMKHRYDGFEKEMNANASRVAVVNQL
ARKLLHVEHPNSEQIMAKQNQLNHKWAELREKAEAKRDELGSAHGVQTFHIECRETLSWI
EDKKRILQETDSLGMDLTGIMTLQRRLSGMERDLAAIQAKLDSLEKEAEAINKDHPEEAE
VIRGRIKQIKVIWEQLTQMLKERDAKLEEAGDLHRFLRDLDHFQTWLKKIQTDVASEDTP
SSLPEAEKLLNQHQSIREEIDNYRQDYLKMMEYGERITAEPSTQDDPQYMFLRERLKALK
DGWEELHQMWENRQQLLSQSLNLQMFNRDAKQAEVLLNQQEHVLSKDDTPANLEQAENLI
KRHEAFLTTMEANDDKVNAVVQFAARLCDEGHFDSDKIHKKAENLNDRRNANRDRAILMM
NKLKDQLMLHQFLQDCEELGEWIQEKNLTAQDDTYRSAKTVHSKWTRHQAFEAEIGANKD
RLLRIKQVSTQLIKEKPELADIVKPKIGELLQQFDNLEKTTKDKGERLFDANRETLMYQT
CDDIDSWMNELEKQIESDDTGSDLASVNILMQKQQMIETQMAVKAKQVSDLESQAEYLQK
TVPEKMDDIVTKKAKVEERFQQLKQPLLERQRQLEKKKEAFQFRRDVEDEKLWIGEKMPQ
ATSSDHGTSLFNVHMLRKKNQSLKTEIENHEPRITLVCNNGQKLIDENHEDSPEFEKLIA
DLKRKYQELKEAVDSREKDLKQNEKVQQYFFDTNEAESWMSEQELYMMVEDRGKDEISAQ
NLMKKHETLELAMEDYADTIRQLGETARQLINDRHPLSDQISVKQSQVDKLYAGLKDLAG
ERRAKLEEALQLFMLNREVDDLEQWIADREVVAGSHELGQDYDHVTLLWERFKEFARDTE
SIGSERVAAVNQMADGLISAGHSDSATIAEWKDGLTEAWQDLLELIETRTQMLQASRELH
KFFHDCKDVLGRIMEKHHSMSDELGRDAGSVSALQRKHQNFMQDLMTLQSQVLTIEDESN
RLQASYAGDKAREITNREAEVASAWAILQALCEARRNKLADSGDLFKFFNMVRTLLLWMN
DVFRQMNTSEKPRDVSGVELLMNNHQSLKAEIDAREDNFSACISLGKELLSRNHFASNEI
KEKLLMLTNRRNSLLQRWEERWENLQLILEVYQFARDAAVAEAWLIAQEPYLMSTELGHT
IDEVENLIKKHEAFEKSASAQEERFSALEQIIFYSDKFYKPDRGKKRSWKNRKPPRRRRR
IRSFLWKNDRDWNEKLKNVFFSSEEVGDSKCCDTKLFLNNERKLFENENKMYDLSGGQND
KVSDSSLPPLPLPDPMEFISIYREVYELLEGMLQRKHEWESTTKKASNRSWDKVYVVMKG
PQLSFYKDAKSYKAAPDVCLKNEQRLDLKNGFIEVALDYTKKKHVFRLKTASGAELLFQA
KDDEEMNQWVSAMGAQCEGGAAAAGPGKSQTLPAGPGQSEQKKRSFFTLKKK
Download sequence
Identical sequences E0VLF6
XP_002426950.1.24195 vb|PHUM287180-PA|EEB14212.1|Spectrin 121224.XP_002426950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]