SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM338390-PA|EEB14993.1|hect from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM338390-PA|EEB14993.1|hect
Domain Number 1 Region: 3961-4336
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 7.15e-99
Family Regulator of chromosome condensation RCC1 0.0025
Further Details:      
 
Domain Number 2 Region: 2982-3353
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 8.02e-98
Family Regulator of chromosome condensation RCC1 0.0027
Further Details:      
 
Domain Number 3 Region: 4460-4795
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 7.72e-89
Family Hect, E3 ligase catalytic domain 0.0000702
Further Details:      
 
Domain Number 4 Region: 448-803
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.66e-86
Family Regulator of chromosome condensation RCC1 0.007
Further Details:      
 
Domain Number 5 Region: 2579-2656
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 9.93e-28
Family CPH domain 0.00069
Further Details:      
 
Domain Number 6 Region: 2755-2941
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.19e-22
Family APC10-like 0.0081
Further Details:      
 
Domain Number 7 Region: 1910-1975
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 4.58e-21
Family Mib/herc2 domain 0.00016
Further Details:      
 
Domain Number 8 Region: 1245-1322
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 4.58e-17
Family Cytochrome b5 0.0049
Further Details:      
 
Weak hits

Sequence:  vb|PHUM338390-PA|EEB14993.1|hect
Domain Number - Region: 2486-2534
Classification Level Classification E-value
Superfamily UBA-like 0.000408
Family UBA domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM338390-PA|EEB14993.1|hect
Sequence length 4834
Comment E3 ubiquitin ligase, putative|DS235341.1:72061:90772:-1|gene:PHUM338390
Sequence
MNLSEQFEFVLRTQSRLDGKWAKTDLQQCFNYDGLSLLWNDMIKDGELTGAFSDGILNSV
GVTSKKGESGHFYCGLRVLTCLCCDGICGPQRGCNCSPCQKLDKDEASRIEIEARKPDPV
QPQLESWIWGPQATKEQLENCISSLNLEQKLLCGNTAGSTLSAKRLLQRLVVFQRYFIAL
SRYYPSDHIKPPLEKLTIPVNSNISYQNVKAHDKATLGLARVGTTAVLNFSFAFLKRAWR
SGEDADLCSEVLQESLEAMRSLPEATLFDESNVSPVWLEVVEKSTKFLQQVVLGDVNSGR
ISGEVPINDQHTALCLLLELAMQRGSLNHILNSVLLLLRLWDKGKYEVENRVLSSGTSAP
LVPLLKRFQNLLSLKSDTSSYIFEEFSSSKVSPTECFLRYCQLPENEDVSVDLRQSAVII
MSYLDRLAAPYSPMPVFGKNQLNGTIYQEVMAWGWLSWSSCHDLGTSPQSCDSIRELGVK
QIVCAERWLLILTLTGKVYIMYYSSETQCPEQIEGFDGKEISKLAAHADGKHSLALSCDG
DVYSWGNGDGGRLGHGDNNSRDQPTKITELVGKNVIHISCGATYSAAVTSSGEVYTWGRG
NYGRLGHGTSEDHTVPTLVVGLKDYFIVDIACGSGDAQTLAVTNTGLVFSWGDGGYGKLG
TGGSDGSKTPKLIEKLQDIEVARVYCGSQFSLALTKSGSVYTWGKGDNHRLGHGSENHVR
FPKLVEGLNGKCIKKVAVGSGHVLALTDDGEVYGWGRNDNGQVGETSETNVSEPTLLTLL
QGKNIVDIDCGPNQSIAWSSSNTYSINLRVAFVVDICEETFCCLNQLLMVVSEGVCRSHD
WPPPQDKECMTVACLNLLRLQLYALISHNIDPKCVGLNPGSSLLTSLRQQIMNLASKNGV
VITIQSAAQAALQVGWSILLPTADERSKTLSSLLPSVGTDPSNVSSGQRFMTDLLVSTLM
ADEGLETALKAAIKGKCSVKKKKKLINDYLKVLYNKDKFFFSVELLNADKDKLNDSMEAM
EDANQSKDPSNLEKNTSTIPLLQLIKQLLKNGCSSTLTKLQSLTGNGSELPGLNSMFNKE
KSERSPSLNLLLRFQRLLICQIYPQSLEERSALDQNIIGAESLLRKYTYQLCSHALEILP
LASSLASKNWKYRFLVLQILTTDVIDVLLPEFLTSLVLLQIEVPLLMYQVDWLQLFNSLL
DSLDQFNRLIRDIEKEDSEDLSWPGIFDIQTYRSPTQLTQEDSMIIRECDLYNHNHDGGL
WIVINGKVYDVQDFKSQALCDGDLLQRYAGKDATQAFTSVNHSLLAKGMMTSYLVGSFLE
DENLEYEKSVIVSPLLDAERTLAYLLGLHSYWLTESTPLQEPEEEAKEWLNASFLTGGLQ
ILLPPNPYEEEKGEARSATSTPGNTPTEEPKQHINGLGRFKIDPVMSFLQALAEYRISDS
QVDALINIIDRYCKQQHFMAHVDFSMEHPVEEVGRLLTAILIKHLQLGQIVLSLVESELR
KEVIKEIPKKFSEVIKIVHNAKWNLIKMRQEKNCSYKEVATPMLDKCRFLLYDVRAATSH
EINALKRLQLLHTLPPWKRNVKKIMSDIRDRKNMVSSKPEDIVNTSIQNQKENDAKKKFK
ESDLEGDKDTCVEDESSCGDNDLADESSESIKDIENSNIKYPSSIFLETCDKNYINLRSD
DSNTLATSIVEFIMQEDCPNVEILKKSMYCQMERVEIRLSGLKMISNLLQKTHLVASVKY
ALLNGWLGNYHKRKMTTFKPIHFLDNIQLVTPYYKAQVTLAQSKISSWVIDMLRQFVIFS
DNNRKSNGFGEKGILKDSLIGWTKRVSWIRFVLSLIAILTRTYKGTEISFVINSGVLSLL
QTLLKQVFQKSVLEPKKEHKITEEYVIYEDSAEKSKGAGTAVSGPELANKLKIGTRVTRG
ADWKWGDQDGPPNGVGRVVGELGVDGWVRVQWDNGSTNSYRMGKEGKYDLKLVEPTPVDA
ETDSDEESTAQLETSLSEIRPEKILKEATINFLINLSLCCGIEADNVQTSSIKLLTGLLR
HIIYHGNKTPESSNQTVFFCQMQQSKWANLGFVRAIACCKSMAVAFTSPAWLNLLLAMAG
KQDHSLAVNLPLQILALRMLKTVLPYWNTDAAAKMNFLDKLFHLMGVTILTCREDGSLQK
DSKLLKPRVPLTATYSSTIGEECVLLLRTLHSLPGWDNCLNKFLLSKLGLAGELLTNSPL
LNIQVGFKKKFFGDNSIKIHSEVIAALSMIGGIDSRLRIGGLVTSDLMEGQGTVCRISQS
GKLVVQLNDSLNQKKLSIGNCKSFPQLQFDLERMPINESSLDMWGNLLAYTTTNISDNRH
ARSVPAFVNSTLLRSQQHQLAAIKACRQLFRHQRILRKILKQPSVEMVLTLEALNEGEDV
ETSSEQFLLQRMMLKATQPSPLKAIFCKEELEVAALNISQHLASEMINKGNRESETATPA
SECSLPSLISSSNKLHNSKKKPRTPSPFLTPLVEQITEMGFSRRGVEFAIRALSANGVDP
TAERLVAWLLENPNVPLSTSDTISSFDGLSDTDSMSDDIDEGNVSYNDRGVTSPSFNLRS
DFLSNDEYALYIRDNIALGMIVRCCKTYEEVHEGDIGRVLKIDREELHDLNVRVDWQQKG
SPYWVRFIHIELVGFPSSLPPPPTIKIGDKVKVKSCVIAPRYKWGSVDHNSVGIVTSISS
NSRDLKVDFPQQSNWTGLISEMEIVQSCHEGIHCYGCQMYPLIGPRFKCKACENFNYCEN
CFYTKKNHRHGFMRITEPGNAAVFAGKPGKYHHAKQLESTPVADEVGIIDDWARCIKTLT
VSSRENWAHRLLDESGLFWESCGPKEKHWIRLEMHQDILIKSLKILLDPLDNSYMPSLII
VYGGDTFSSLIELATINIRNTDTLVTLLSDVKEFYSCIEIAIKQCWNGGINCKIHSLLIT
GKKRLVNDELPLNVSFLATDYEEIPEVKTLSETSSHSKLWSDSPTKVFVWGLNDKDQLGG
LKGSKVKVPVYSESLTALKPIHIAGGSKSLFIVSYDGKLYACGEGTNGRLGLGHSNNVAT
PCQLTSLNQYVIKKVAVHSGGKHAMALTLDGKVFSWGEGEDGKLGHDNRLSLDRPKMIEA
LKSKRIRDIACGSSHSAAISSTGELFTWGLGEYGRLGHGDNLTQLRPKLVKALLGHHIVQ
VACGSRDAQTLALSAEGLVFSWGDGDFGKLGRGGSEGCDIPHNIERLNGLGVCMIECGAQ
FSLALTKFGQVYTWGKGDYFRLGHGSDQHVRKPTLVESLSEKKIVHVAVGALHCLCATDQ
GQVYAWGDNDHGQQGNGTILVNRKPSLVLNLEGVRVNRVACGSSHSIAWTTSDTHAPNMT
EPVLFTALKDPLGALCLKTDSVVNEEEESKQNSSASASNSYHSTLSQLVLPLASNVAKQQ
ALQHILVALQILHARECVVAALSSHSSNVTSPPHINLKYSANSPVEDGSNSSAIQISQGG
GEALANANEAIPSSSRVSPESEIENPVMIFQSLTSSASLSSKSSKLSASAMSVIAATVTS
HAQVIGTTEPNDPSIPVLDDFSCLLNQNDARVLVDFLKLAVAGRAGPNAKETISNVLIAM
AASSSAVSDMLLELCVTELEDVAMNTHSFQSKLQPVTQESSHPYINGVSLTGHVKIPGAE
ALHVEFDKQCSTELRHDPLVIIDGSGKTASVRSGREWSDWSSELLIKGDELRWKFTTDGS
VNGWGWRFTVYPIAEPKICKELGSDRAVLSQPSMELAMCLLDSRLGLSTNRNLIARLAAA
LAACAQLSTLLASQRIWALQGLRRLMSSGLSKLIAVHTIDSENRDSALSTLLKGLPQALL
RQYEYEEPLVKNGRHLMHSSFFKVLVALACDLGLDSFSHSSENHHKWCWFRRYCIASRVA
SSLINRNSLPQNFCLEVKKKIAEMIPDDETIQCHHEDHALFKQEQDRQLLLWLNRKPEDW
TLTWGGSGTIYGWGHNHRGQLGGVEGPKVKIPTSCEALSALRPVQLVGGEQTLLAVTSDG
KVYATGYGAGGRLGLGGTDTILTPTLLESIQHIFIKKVAVNSGGKHCLALSTDGKVYSWG
EGDDGKLGHGNKNGCDHPQLIDALQGKEIVDIACGGAHSAAVTAGGEIYTWGKGRYGRLG
HGDSEDQMKPKLVETLIGFKVIDIACGSGDAQTLCITDDDNVWSWGDGDYGKLGRGGSDG
CKIPMKIESLAGLGVVKVECGSQFSVALTRSGSVYTWGKGDYHRLGHGSDEHVRHPKKIA
ALQGKKIICIATGSLHCVACSDLGEVFTWGDNDEGQLGDGTMNAIHRPRLVVTLQGKNIN
RVACGSAHSLAWSTNKSTSATHLPVDAPMEYDLVRDISLPTLRNRLVLLHHFSELVSPNV
AMFPMEGEGSLDQLRDILVYSVKEATFRKVIQTTMVRDKQHGPVIELNRIQVKRSRSKGG
LAGPDGMKSVFGQMVNKMSLLTQESLFLPHRVWKVKFVGESVDDCGGGYSESIAEMCDEL
QNGSLPLLIVTPNGRDDTGTNRDCFLLNPNAKTTHHLQMFKFLGILMGIAIRTGSPLSLN
LAEPVWKQLAGMTLTPADLTEIDRDYVPGLLCIRDMDPSEKVFQTLEMPFSTPSASGVDV
PLSTRYRYVTIDNRQEYVRLALNCRLHEFDKQIAAVREGMAKVIPVPLLSLFSGYELETM
VCGSQDIPLNLLKSVATYKGIDATAPLVQWFWEIMEDFTNQERSLFLRFAWGRTRLPRTI
ADFRGRDFVLQVLDTYNPPDHFLPESYTCFFLLKMPRYSCKSVLQQKLKYAINFCKSLET
DEYARVAIPGNAIVSTSSDSDDMESIASDGPISV
Download sequence
Identical sequences E0VNN7
vb|PHUM338390-PA|EEB14993.1|hect 121224.XP_002427731 XP_002427731.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]