SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM351560-PA|EEB15145.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM351560-PA|EEB15145.1|conserved
Domain Number 1 Region: 103-402
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 4.73e-34
Family NodB-like polysaccharide deacetylase 0.014
Further Details:      
 
Domain Number 2 Region: 31-93
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 7.32e-17
Family Tachycitin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM351560-PA|EEB15145.1|conserved
Sequence length 481
Comment hypothetical protein|DS235354.1:682192:684398:1|gene:PHUM351560
Sequence
TNIFFLFFTLDKKKNLNNFSVVSQTKDKEFVCPDVEGNGNFADPATCRRFYQCVDGYPYL
NRCPSGLYFDDINKLCTFKSEARCGPIPTTPAPITEAPVDLAVKCNTSECSLPYCFCSKD
GTKIPGDLDPEDTPQMIILTFNGAINQNNYEQYQKVFPSTRKNPNGCEIRGTFFVSHEYS
NYNMVQQLSHDGHEIATETISLQRDLQDKGYEEWVGEMIGMREILRHFANIPKQDIVGMR
APFLKPGRNAQYEVLEDFGYIYDSSISIPPLKVPIWPYTLDYKIPHECKSGTCPTKSFQG
IWEVPLNAHYVETYEGGHCPHLDQCVLHNHSEDDVFEWLQEDFLRYYEQNRAPYMMPFHT
NWFQIKELEKGLQKFLDWTQTLPDVWFVTITQALVWMTDPTETKTLNNYDAWNCQKREIS
TPAPCNLPNNCALSFKPGENNITTTRYLVTCRDCPAKYPWLGDSEGTGIPGRDNYTPESR
T
Download sequence
Identical sequences E0VP39
XP_002427883.1.24195 vb|PHUM351560-PA|EEB15145.1|conserved 121224.XP_002427883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]