SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM352030-PA|EEB15163.1|kif1 from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM352030-PA|EEB15163.1|kif1
Domain Number 1 Region: 2-358
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.24e-127
Family Motor proteins 0.000000000106
Further Details:      
 
Domain Number 2 Region: 472-572
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.09e-25
Family FHA domain 0.000035
Further Details:      
 
Domain Number 3 Region: 1435-1498,1525-1622
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-21
Family Pleckstrin-homology domain (PH domain) 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM352030-PA|EEB15163.1|kif1
Sequence length 1674
Comment putative|DS235355.1:7781:18378:-1|gene:PHUM352030
Sequence
MSSVKVAVRVRPFNNREISRECKCIIEMCGKTTSIINPKAPPGTKEAIKSFNYDYSYWSH
DCTDSSFSTQTMVYKDIGEEMLEHAFEGYNVCIFAYGQTGAGKSYTMMGRQEEGQEGIIP
MICKDLFGRIKKTASEELKYSVEVSYMEIYCERVRDLLNPNPKGHLRVREHPLLGPYVED
LSKLAVTSFDDINHLIDEGNKARTVAATNMNETSSRSHAVFTILFTQQKFDSTTELSSEK
VSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEISAKKKRKQDFIP
YRDSVLTWLLRENLGGNSKTAMIAAVSPADINYDETLSTLRYADRAKAIVCKAIVNEDAN
AKLIRELKEEIQRLRDLLRAEGIEVHEGDDGVRLMKNNEINQPTNTPSTLAEEAVDQLQA
SEKLIAELNETWEEKLKRTEQVRVQREAVFAEMGVAVKEDGITVGVFSPKKTPHLVNLNE
DPSMSECLIYYIKDGTTRVGSADATIPQDIQLSGSHILSEHCIFENKNSVITLIPKNGAM
CYVNGREILEPIVLKTGSRVIFGKNHVFRFNHPEQARERLEKSEIEKLSPAETPSNGEQV
DWNFAQIELLEKQGIDLKLEMDKKLLILEEQYKKEKETADQLFEEQRKTYEARIDALQKQ
VEEQSMTMSMYSSYTPEDFNNEEDIFVNPLFEASCTWSDREMQLAGWAFKKWKYHQFTSL
RDDLWGNAIFLKEANAISVELKKKVQFQFTLLTDTLYSPLPPDLLTPGVTDDDDDERPFS
RTIVAVEVLDTKNGATHYWNLNKLRQRLELMREMYHNEAELSPTSPDYNVENLTGGDPFY
DRFPWFRMVGRSFVYLSNLIYSVPLIHKVAIVNEKGDVKGYLRVAVQPVFEENSEYAVGV
RQSARITFENEVYGSKTNKKLQEKINIEERIVEGSPECYNKNEDCECDTDSGKGDSSVGS
DLKEEDIPDHLKLGKEFTFRVTVLQAVGIPTEYADIFCQFNFLHRHDEAFSTEPVKNTGK
GNPLGFYHVQNITINVTKSFVDYIKTQPLVFEIFGHYQQHPLHRDAKQEGNQYVRQPPKR
MLPPSIPISQPVRSPKFGVLPSPSTSHVHAKYDILVWFEICELAPNGDYVPAVVDHSDDL
PCRGLFLLHQGIQRRIRITIVHEHAPELHWKDVRELVVGRIRNTPESDEEDNDGSVLSLG
LFPGEYIENLEDDRCMFRFEAAWDSSLHNSALLNRVTAYGEHIYMTLSAYVEIENCGRPA
IITKDLSMVLYGRDARAAPRSLKHLFTGGYRNSEANRLSGVYEIVLRRASEGSPGVQRRQ
RRVLDTSSTYVRGEENLHGWRPRGDSLIFDHQWELEKLTRLEEVEKVRHMLLLRERLGFD
KSFPSRTHDFTKSEKEVCNMVAKANTENKSNSLIKTNSDICDTKFILNDREKQLLLKCIK
LIQGNIPNKELNISKISSPVDDCDVSVNMSTTAAYTQEICSSDSTRIDQLPNVEGILAPQ
PLMDKPQISNESLVLYIPEVEEIRISPIIARKGYLNVLEHNSNGWKKRWVAVRRPYVFIF
RDEKDPVERALINLTTAQVECSEDQQAMVRVKNTFSVVTKHRGYLLQTFCEKEVHEWLYA
INPLLAGQIRSKLARKRLLLNGSCLQQQQISPHHKYYTQPQQQQQQQLLAKEDK
Download sequence
Identical sequences E0VP57
XP_002427901.1.24195 121224.XP_002427901 vb|PHUM352030-PA|EEB15163.1|kif1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]