SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM391120-PA|EEB15837.1|Sorting from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM391120-PA|EEB15837.1|Sorting
Domain Number 1 Region: 33-160
Classification Level Classification E-value
Superfamily PX domain 5.63e-27
Family PX domain 0.00088
Further Details:      
 
Weak hits

Sequence:  vb|PHUM391120-PA|EEB15837.1|Sorting
Domain Number - Region: 288-368
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000785
Family Myosin rod fragments 0.0049
Further Details:      
 
Domain Number - Region: 195-260
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0868
Family BAR domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM391120-PA|EEB15837.1|Sorting
Sequence length 421
Comment nexin-4, putative|DS235442.1:437808:440187:-1|gene:PHUM391120
Sequence
MWECYILIKINLKIIVNLTLILSDLLLCIKIKSFSVSEAEKRINGTLNLREYFTVYLIET
VVKNPDFKKISTKLGTIWRRYSEFEQLHFYLEITYPYLILPPLPEKKILFGWQKSGSDTF
DPDFVDRRRAGLENFLIRTASHPLLCYDKLFLGFLQQEEGWHELCKETGYLQQTENKLKA
LAALPSRIKKPDERFEALKDYSNELNTHLQNLLKTRTRLAERYYTIYKLHANYGRVFSEW
SAAEKTMGDGLQKAGHFLDSFAASIDLASEEEEVIADQLKQYLFFGASVQAVCKRRDMLQ
LQLQRAQDYIDDRVNQMEQVQKGKVSFMSRIFGTTDRLETKELRVNAVEQRIQEGKINMK
AIVDELNDFTKEALLDYERFDKQKTLDVKETLGNYVGIQIKLSKQGLQTWTHVKECLNSF
S
Download sequence
Identical sequences E0VR31
vb|PHUM391120-PA|EEB15837.1|Sorting XP_002428575.1.24195 121224.XP_002428575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]