SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM477850-PA|EEB17683.1|ran-binding from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM477850-PA|EEB17683.1|ran-binding
Domain Number 1 Region: 1450-1579
Classification Level Classification E-value
Superfamily PH domain-like 2.61e-38
Family Ran-binding domain 0.0000674
Further Details:      
 
Domain Number 2 Region: 1939-2066
Classification Level Classification E-value
Superfamily PH domain-like 8.75e-38
Family Ran-binding domain 0.0001
Further Details:      
 
Domain Number 3 Region: 28-187
Classification Level Classification E-value
Superfamily TPR-like 0.000000000522
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 
Weak hits

Sequence:  vb|PHUM477850-PA|EEB17683.1|ran-binding
Domain Number - Region: 1123-1171
Classification Level Classification E-value
Superfamily PH domain-like 0.01
Family Ran-binding domain 0.023
Further Details:      
 
Domain Number - Region: 651-701
Classification Level Classification E-value
Superfamily TPR-like 0.0253
Family CT2138-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM477850-PA|EEB17683.1|ran-binding
Sequence length 2188
Comment protein, putative|DS235818.1:189950:199682:-1|gene:PHUM477850
Sequence
MLHTKQDVDHHVHEIFRNLKSENERNLKCYQIAKLYYKVKDYNSAIKYINRYILVSSNSA
AAFRLLGDCYFALNLKDKAFNSYKNSLELNANQHDLILKICSLIMESGCTGVSKPEYWLH
RAESIFPKSPVVFQLKEYLIKTQQSGVESTGQLDKLIASEIKVRPFDVNVRIRLLNFYLE
TNRSKLAYTNALELEEKQLFSNNCRWYECLCNVVQAYEKDNKDLDFIFFIKKLYFLERKV
DLFMEEFQDEVKTISDCCSALFTFDQSLHSFSKITTVPNEDTNFFKECLKHLRTQLSFHL
ATLILKKAKKEYGLWPKAQRTASPLLLQASQSSMDLNSAWYNMWQGKKNLDKEVKMWSNC
AASRVSQAGHILQSWCQNNEAKFLKKVFQNCGGKWQNLAYQDIFYSKEQSQGAETSHFVN
DPFFAFIPTQIITKAELKQFDDVSQLNYTHSLHHIVWLGLSYFDSNGQLSHDFKCKTFPN
LQFTVENLSQTGPESLNQLDVDAFVYASVLCGKAATENEVRNDRPDKLPVSISEELCTSA
QSEWWQAVYQSYKNELSQNVSQARLKLMKGIETIRVIEQHGLDVKLIVKLAKLFQERAAG
SKNTSEITGLEGRAYLYWSAAIPLLERLEKGQKLRVFPNRLFDYKGEELTANEIKAYLED
GRLYLGCRLMKLGRTEEAIDAFQKLKGPYAAFYQGLIYEKLASEEINHLPESITSENRSQ
HIIFLTRARDAFYLTLDRLRSPGVDFNHPLNSHLQDHLETVEKQLAVIDSDNSLNRNGDT
ESDETDIVPHRISPDVDDNMESMINIYNASNLLGMKSHGTPRTSKQNFLEKNSSRFEARP
SPERLDAQLRHFMMANNSGLQAVSDQLKEIKSIIQIELKDLGCITRDLLAEMKKWSDKID
GTVKKVIDAVKPDDILNFAEEDYENLNQMNLPYDSQYQSYLLNRQMTGTQGTSTVTYGNS
LSSPISSVITGNQMIPSPFYTGQQQAVSQLDPALLYQSLGTPSLSVIIPPQHIRSTVPSS
VQSTSHNQVHPFQIQMPPQVQLIKESPTEKLNSIAPSTQIINSFGNLSTGQISTAAPASL
KSPIQNTPLSGNVSSETTPETVKTTEKILQEPKMKPEINLQKKKNDVKLYGSKVEIFFLE
NNEWKKQGNGVIEIILDEDSKMGKFTLLQDNSNVPYVYDLNPNTAVKCVKFNKEAAAAAA
FVWSLKNLQSPKSETNNKASPLDVIQKSYFKLNNDGEDEKFEMALNKVYKILNFKKENII
GKSKAINIVKETTNKIASIKEKSENSSEKNNNANLKTNFGGFIFNSPPIIQPPSLKLNAS
NEKPKEQTKNSPFAAFSFPTTTTTKVTTTTLSVTSTTTNTNTVPSLKSIMSESPSNKNTS
SNNVNLFSSVKADPNSFKKNENFVGFAGKDVQVFGYLNKSTSKESSKTDSNQKENDKEGG
DDDFIPTAEFTPAVDLPDLVDVKTGEENDEVLFEHRAKLLKFYSDSKEWKERGIGNIKVL
LNQETGKVRLIMRRELVFKVCCNHYLDESMEFKPLPKNPNVLSWCAQDYSDGDLKPECFA
LKLKTQELMEKFHTVIKNTQAKMKNGKVEGMGSEEQSQKEKSKEELVPLSELFKPKPGST
ANSGALNVSSASSNPSFSKPSTEFSFGIKNPVSTRGETLPNTTSTISVTKSSFGSATTTT
VSSVFGGTTTTTTNSNIFGGASATASSVFGGAPVFASKNIFGAGTATTGNVFGSATPPTG
NVFGGATPPTGNVFGGAPATKGNVFGGAPATTGNVFGGGSTVNTFGGANNTFSTSGNIFG
SNVSNSSSTTNANVTNTGTFSMAPSSSNLSNSPNTSQPNSSNFSTSNSSNIFGGTSLSKS
NFVFGTPKTDSEKPTQFSFGSSNLKLQEKDKFSFSMVVRDDSNKNQSLSPRQEKLSESYE
KSESSPEKTEANDQTNAATPEKVKLPTGEEDEELMYEQRCKLYRFYKDEEKDIKEWRERG
IGDVKILKHKETRKIRLLMRRDVVLKVCLNHYVTSDIEFIKKDEKSWQWTAPDFSDGEVQ
YDMFAIRFKTPEIASGFMKALDDVKNNVAVTPIKKAGGDDESTTETMKNFSFASLNNSQS
LDNAKQSIKEKGGTPLVKKSDDDITVVFQNQVTAEQREKAASLHLPPNFYSYLQARDCPG
CVGCDAEDENSILGKLSETTLKTQSNSV
Download sequence
Identical sequences E0VWC7
XP_002430421.1.24195 121224.XP_002430421 vb|PHUM477850-PA|EEB17683.1|ran-binding

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]