SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM488290-PA|EEB17760.1|Spectrin from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM488290-PA|EEB17760.1|Spectrin
Domain Number 1 Region: 178-423
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.68e-84
Family Calponin-homology domain, CH-domain 0.0000169
Further Details:      
 
Domain Number 2 Region: 2997-3153
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-34
Family Spectrin repeat 0.00051
Further Details:      
 
Domain Number 3 Region: 1726-1880
Classification Level Classification E-value
Superfamily Spectrin repeat 3.57e-31
Family Spectrin repeat 0.00033
Further Details:      
 
Domain Number 4 Region: 443-564
Classification Level Classification E-value
Superfamily Spectrin repeat 6.54e-31
Family Spectrin repeat 0.0001
Further Details:      
 
Domain Number 5 Region: 3422-3575
Classification Level Classification E-value
Superfamily Spectrin repeat 2.4e-30
Family Spectrin repeat 0.0009
Further Details:      
 
Domain Number 6 Region: 3121-3257
Classification Level Classification E-value
Superfamily Spectrin repeat 4.19e-30
Family Spectrin repeat 0.00017
Further Details:      
 
Domain Number 7 Region: 1837-1985
Classification Level Classification E-value
Superfamily Spectrin repeat 1.28e-28
Family Spectrin repeat 0.00097
Further Details:      
 
Domain Number 8 Region: 839-961
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-28
Family Spectrin repeat 0.00099
Further Details:      
 
Domain Number 9 Region: 1521-1667
Classification Level Classification E-value
Superfamily Spectrin repeat 5.43e-28
Family Spectrin repeat 0.00041
Further Details:      
 
Domain Number 10 Region: 731-886
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-28
Family Spectrin repeat 0.00078
Further Details:      
 
Domain Number 11 Region: 3879-3990
Classification Level Classification E-value
Superfamily PH domain-like 8.58e-28
Family Pleckstrin-homology domain (PH domain) 0.00053
Further Details:      
 
Domain Number 12 Region: 3218-3363
Classification Level Classification E-value
Superfamily Spectrin repeat 6.72e-27
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 13 Region: 3528-3682
Classification Level Classification E-value
Superfamily Spectrin repeat 9.6e-27
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 14 Region: 2362-2521
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-26
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 15 Region: 2578-2731
Classification Level Classification E-value
Superfamily Spectrin repeat 2.95e-25
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 16 Region: 2257-2411
Classification Level Classification E-value
Superfamily Spectrin repeat 5.23e-25
Family Spectrin repeat 0.00076
Further Details:      
 
Domain Number 17 Region: 2804-2940
Classification Level Classification E-value
Superfamily Spectrin repeat 1.56e-24
Family Spectrin repeat 0.00061
Further Details:      
 
Domain Number 18 Region: 1939-2091
Classification Level Classification E-value
Superfamily Spectrin repeat 2.04e-24
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 19 Region: 1245-1358
Classification Level Classification E-value
Superfamily Spectrin repeat 6.84e-22
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 20 Region: 2149-2292
Classification Level Classification E-value
Superfamily Spectrin repeat 1.23e-21
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 21 Region: 1112-1246
Classification Level Classification E-value
Superfamily Spectrin repeat 3.44e-21
Family Spectrin repeat 0.00083
Further Details:      
 
Domain Number 22 Region: 1425-1562
Classification Level Classification E-value
Superfamily Spectrin repeat 9.6e-17
Family Spectrin repeat 0.00056
Further Details:      
 
Domain Number 23 Region: 573-672
Classification Level Classification E-value
Superfamily Spectrin repeat 6.02e-16
Family Spectrin repeat 0.00077
Further Details:      
 
Domain Number 24 Region: 1008-1073
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000774
Family SH3-domain 0.00088
Further Details:      
 
Domain Number 25 Region: 2736-2839
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000048
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 26 Region: 3687-3747
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000662
Family Spectrin repeat 0.0009
Further Details:      
 
Weak hits

Sequence:  vb|PHUM488290-PA|EEB17760.1|Spectrin
Domain Number - Region: 1360-1458
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000878
Family Spectrin repeat 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM488290-PA|EEB17760.1|Spectrin
Sequence length 4215
Comment beta chain, putative|DS235822.1:163164:185291:1|gene:PHUM488290
Sequence
MADDSEREKKYRDNNNSSKKPLYTISSWDEVHPTTSTIRRLPRENAEYKPRPKTVYFADN
PEYFVLNRRSDKKVFDCKKKPQTNNDRPTSVPPDFYKIVKVETESSESPRNRYQSILKNN
DVTERKQRRDVPRMGSNWINIKSFQTPMVKTVIKHKVEYEAEGHYDRGRRPSQAAMTQRE
DVIKFEQGRIKALQEERLHIQKKTFTKWMNSFLQKARMEVEDLFTDLADGKKLLKLLEII
SGEKLGKPNNGKMRVHKVENVNKSLAFLQTKKVQLESIGAEDIVDGNPRLILGLIWTIIL
RFQIQEIEIDVDEDNESSEKKSAKDALLLWCQRKTNGYSGVAIHDFTSSWRNGLGFNALI
HAHRPELIDYQSLIPSRHIENLNNAFDVANTELGIPRLLDAEDVDSSRPDEKSILTYVAS
YYHTFARMKNEMKSGRRIANIVGQMMDADRKKDYYERLTTDLLEWIRRKVIELEDRNFPN
SLEGIQKELLRFKQYRTIEKPPKYKERSEIEALFFHINTLLKSLNQPCFQPSEGNLVQEI
QRAWEGLETAEHRREVALRQELLRQEKLEQLHYKFVRKSVLREGYVKEMIQVLSDPRYGN
NMAQVDATVKKHEAISADILARKERYSDLSAMSAELRNENYHGADKVQQREEEILKKWNE
LLDLLEKHKNSLNTQSNLMATLREIDTLMGTIQDLQVQFESEGVGSHLLSVEDLLQKHAL
QELQVTAVGETLGKLRRHGQQFVTAKHKDAPALQERLNLLDKAYNNLVQSSEERRSRLED
ARNLFQFVQDHEEEESWVIERQRICMAAIVAKDLRAVLSLQQKQKALQDEMKARRMKSDQ
LCEAGQRLIIDKHPKAKDISSRIQSLQKEWKHLYELADLRKKHLEDAAEAFQFYTDANEA
ESWLKEKMALVASTDYGVDEPSAQALLARHKDLRGEIQAYKGDITSLNTHAQKLIKSGIA
NLELSTEPEPPQEIEEWTTETRLVPQEVWEDEPYERIENRIVIENRLCPQVRSLYPFSGQ
GMEMQKNEIMLLLHKTNQDWWNVRKENGTEGFVPANYVKEIEGKIIPVQIQRPEKIKDTR
KIKKTKMVRQTVRVKKPLVPKSQGRLPKKKVDDSQNVEKRQKNINDTYGELLNLSEKRHL
LLEDSIRLYGFYKECDDFEKWIKDKEKMLKTDDGMDNVETAKRKYEKFLTDLSASAKRIE
SLDKAVDEFVAQSHSHLDKVKARQKQIHQLWNHLNLLKAEKEKSLEGASSVEVFHRTCDE
ARDWMAEKLTQLDGAEHGPDLKTVQALQRRHRHLERELAPVEEKVNRVNLLANSVKSSYP
HERANVTTRQKEIKDLWEKVINKAKDKRSRLEDAVGQQVFTNSSKNLLVWADSVKEALRA
DEPVRDIATAESLQKKHSELDDDIRAHEDEWSEVVSLGKKLLNRNPQLDDVRERLMKLDA
EYEALRRGWIEKDNWLKQCLDLQVFNREADQIDASTSAHEAFLEFSEVGNSLDDVKAAEK
RHLDLENTLAAQDEKLLSFSDFADILISKHHYDSKNIDNKRHQVIARRQAVKDLADARRS
ALSAANNFQEFAAKVDDLKSWVSDKTKVASDESYRDLSNLERKLQKHEAFERELKANEGQ
LRAINKAGQGFTNDNNYRSDDVSKMLKTLNAEWENLVKLSRDKGKRLRQAAAQHTYNRTI
EDARLKLEEIKQALQSEQVGNDLRHCKDLLKKHNALEIDLATWEGKINDLTAVAEDMAQE
GHFDAENILKASQDCQKRFEDLKEPAKRRRAMLEESLKFHKFGFELDAELQWVREHKPLA
TSTVLGQNLHQAQSLFKKHKKLEAEIEGHQPMIDKTLSNGQQLLEQNHLKTPEIEALCKK
LESEWQDLEKSTKERAKKLELSLKAQEFFFEAGEVESWLTEKNDVLSSTDYGRDRDAATK
LLTKHKALELELDSYNGIVTEMGHVADKMVSSGHPDAKAILAKQQLLSQQMKLLQKLATS
RQQRLMESMYRHEYFLESAELDQWIKEQMLTATSEEYGQDYEHLLLLQSKFDDWKHRLDA
GSERFNQCEELAQKLISNDSPYVADIEKRQDQLSESWAKLLEQMNNREQRLNAAGEIHRF
HRDVADALSRIQEKNAALPEDLGRDLNSVIALIKRHEGFENDLVALEAQLQILIEDAARL
QAQYPGQNAAQIEQQQKLVLDHWAALQLRASDRRELLNEACDLHKFLSQARDLMSWASGL
RANMMTEEKVRDAASAQILKAEHEAVKAEIEAREDVFGKVVALSEEIIKNNHYATPEITE
KLTALLDERQRLHSAWQHKKVHLDQLIDLHFFLRDAKQIYTTSSAQEAALNNNDFGTTVD
EVASQVKKHEAFEKLVGTQEERVLALQEHGAKLVQQNHFETPTIKQHLSDVVARRMKIAQ
LCQKRRQNLEDCLLHAQFVRDVAEAETWIGEKQKRLQADVNQGEETASLEDKIKKLQKHQ
AFQAELSANQPRITNIKGQCDQLLSKKHSSSKQIQLQWNNLLESWKKLLQDADNYGRGLE
EAQDILEFNNQVEKIEAWIRDKEMMVQAGEIGKDYEHCFALQRKLDDVDSDMRVDDARIK
SIYTLADKLIRQGRSDTQVKSRRDKLSSKWHALQGALSSYRDRLGGALEVHSFNRDLDDT
ISRVAEKATAMSSTDLGRDLAAVEQLKRRQETLERDMTAIEGKMKEHEGTAQVLIKRYPE
MSGSITEKSSHLKQQWEKLQDLTLKRRNALQAAYTRHKFHSDLKELQDWIEEAINKMKGK
ELPASVAEAEAAIHLHGERKAEIDGRLKKAQTLKDFGLKLISEEDDEKLKSSLDVLDDLQ
KDLNEACEERRKTLQQALQLAIFRDQADQAERWLDNKEAFLNNDDLGDSLPSVEALIQKQ
EAFEKTLAAQSSRIEDLKKFAHEIVADKHYDQSGIEARLNLVTSRKIKLKESSEARKKKL
LETKKLLQFLRNIYEVQTWLHGKTQIANDENYRDSSNLQSKIQKHAAFEAELQANKDRIN
GVINEGEKLIAENHFASDDIDSHLSELKSHWDNLLKASKDKKEKLNDAYQALIFIRSLEE
LESWMNEVEGILSSEDHGKDLASVAHLLKKHAALENDVDAHGENVKVLKENAALFDSSEH
FMKEEIDERFSAALKRYHSLHEPMQIRKENLEDSLLLHQFIRDVDEELEWLEEKEPTATS
EDLGSSLTTVQNLQKKHQALEAELVSREPVISALGARAQQMARSNHFASGEIEKKMQELS
QNFERIKDLASVRKLRLLDAVESQTFYTEASDASTWLKEKKPQLTSSYLGKDEDSVSALL
KKLASIQRDLSAFESTVEKLRKLSNGLIERGHFDSSNIKLKQSELEVSYAELLESSKIRE
SRLAESKKYFKFIREVDEVAEWINDQTALAASEDYGSDVEHVELLIKKFEAFISSLNAAE
SRISKAIENGMKLVNENNPESHKIKEKIKETQQLWDDVKELAHARQEALAGAKQVHMFDR
AADETIDWIDEKEAALTLDGFSQDLETIQALVRKHEGFETELAAVKKQVESVKNEANKLA
SMFPDTREHIEVKQEEVCDSWTSLLKKANQRRDQLMQAEQLQSYFDQHRDLMAWLNEMIA
KITAPDLAQDVTGAEALIARHTEHYAEIAARSDEITKFHVDGDKLVNQGHFLSEEVGEKI
RILKDRYKLLLDTWNKRKDIYEQNLDTQIFKRDADLLENWMTAREPVLRDGQVGESINQV
EDLLRKHDDFEKTISAQEEKCKALQRITLLEKYFQQQKEAEQAARLAEKERIEREKIEAR
KRKEIQRITDERRREDEKRRQQETRPSEINGNAVVGSRTLQVPESPNLHKTGSFSQLIGD
KMRREMKRAESMKIETKKPKRTPSFTTRRRTQSFRKLPPVEIRGLLDRKQDLQSGGKKAP
VRSWKTFYTVLCGQLLCFFKDKEDFVNSKAASSPVSILKAKCEKAQDYTKRKHVFRLCCT
DGSEYLFLADSEEKMSDWINKISFHAQLPPSMQLLSYDESQKNNEDRISNTTGDVSSGSS
RTSSPEPTSPAKPIQTQTQFLAQYGPPIPPRSAPPPIPTGVPMRQKSMEMVPVGKMVHTI
PTGTVWTHHLQSLSPPPLPMTQPPRGYQYGGHQGSLSQNELSGISYNHGPTLRSEYRDPN
SWIPHNNSIYNHGYGDISPPPPRPASMLAAPPSELNRRASESSSESELQNAGRNSKEKRQ
GVLSNFFGRRKKPSN
Download sequence
Identical sequences E0VWK4
vb|PHUM488290-PA|EEB17760.1|Spectrin XP_002430498.1.24195 121224.XP_002430498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]