SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM501900-PA|EEB18114.1|zinc from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM501900-PA|EEB18114.1|zinc
Domain Number 1 Region: 270-330
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.75e-18
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 209-269
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-16
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 3 Region: 313-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000439
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 4 Region: 355-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000724
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM501900-PA|EEB18114.1|zinc
Sequence length 443
Comment finger protein, putative|DS235833.1:59731:61549:-1|gene:PHUM501900
Sequence
MDQEDLNMEIPLLIQEHCESGIYIDKFNTCDNIVEDETNLFKNGDDLLNNEAIVISTDSI
KELISGNSAMDNHTYVLEDNQCDALIEKPLLGDSCIAKDDNISEFLLDNNNGRDSEIYLN
GQMIELADGTTAFLETSRSVKGDDYSQNKLYNGNVIYVVSGPMLNNDGENVKSFKRDDKA
EEISPVIPPEQKQEKSKGFQCSYENCNKSYSSFHHLKVHLRVHTGDRPFRCSVEGCNKAF
STGFGLKTHFRTHNGERPYMCSHENCEKGFKTSGDLQKHIRTHTGERPFVCPIPNCGRSF
TTCNICKVHIRTHTGERPYKCTYPNCDKTFASVTNQRNHMRIHSGEKPYVCSVEKCGRRF
TEYSSLYKHNMVHRQQPHLCLICGKTYRQASGLMMHTKTAHGELQETYLMIDKNSTEEDE
EEEENVRENEQTAIFFVNNLKMV
Download sequence
Identical sequences E0VXK8
vb|PHUM501900-PA|EEB18114.1|zinc XP_002430852.1.24195 121224.XP_002430852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]