SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM507350-PA|EEB18272.1|predicted from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM507350-PA|EEB18272.1|predicted
Domain Number 1 Region: 955-1181
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-39
Family Laminin G-like module 0.0042
Further Details:      
 
Domain Number 2 Region: 1207-1396
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.16e-35
Family Laminin G-like module 0.0039
Further Details:      
 
Domain Number 3 Region: 440-566
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-30
Family Cadherin 0.00087
Further Details:      
 
Domain Number 4 Region: 209-339
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-23
Family Cadherin 0.00021
Further Details:      
 
Domain Number 5 Region: 99-221
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-19
Family Cadherin 0.0007
Further Details:      
 
Domain Number 6 Region: 545-681
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000002
Family Cadherin 0.002
Further Details:      
 
Domain Number 7 Region: 1186-1224,1419-1496
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000033
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 8 Region: 327-452
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000728
Family Cadherin 0.0023
Further Details:      
 
Domain Number 9 Region: 1527-1570
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000272
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 10 Region: 2-50
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000002
Family Cadherin 0.0055
Further Details:      
 
Domain Number 11 Region: 667-766
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000571
Family Cadherin 0.0086
Further Details:      
 
Weak hits

Sequence:  vb|PHUM507350-PA|EEB18272.1|predicted
Domain Number - Region: 43-68
Classification Level Classification E-value
Superfamily Cadherin-like 0.0565
Family Cadherin 0.0089
Further Details:      
 
Domain Number - Region: 73-105
Classification Level Classification E-value
Superfamily Cadherin-like 0.0942
Family Cadherin 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM507350-PA|EEB18272.1|predicted
Sequence length 1764
Comment protein|DS235843.1:8229:19563:-1|gene:PHUM507350
Sequence
MTGAIYVAGALDYETRKRYELRLAASDNLKENYTTVVIHVKDVNDNPPVFERPTYRTQIT
EEDDRNLPKRVLQYTLRLSASDSLSENYTTVVINVRDVNDLPPVFSSTMYSATLQEEHEG
PYPVKLLQVTATDGDKDRHQNIVYFLTGQGIDPDNPANSKFDINRTTGEIFVLKPLDRDQ
PNGRPQWRFTVFAQDEGGEGLVGYADVQVNLKDINDNAPIFPQGVYFGNVTENGTAGMVV
MTMTAVDYDDPNEGTNARLIYSIEKNVIEEETGSPIFEIESETGVIKTAVCCLDRERTPD
YSIQVVAMDGGGLKGTGTASIRVKDINDMPPMFTKDEWFTEVDETAGASLPEIPILTVTV
HDEDETNKFQYKVIENSGYGADKFTMVRNNDGTGSLKIVQPLDYEDQLQSNGFRFRIQVN
DKGEDNDNDKYHVAYSWVVVKLRDINDNKPTFERPNIEVSVYENAEVGKSLETFKATDPD
QGGRSKVSYAIDRSSDKKRQFAINQSGTVTIQRNLDREETPRHQVKILAIDDGIPPKTAT
ATLTVIVQDINDNAPRFHKDYRPVLPEHVPPRKVVEVLATDDDDRSKSNGPPFIFRLDPN
ADDVIRASFKVEHDQKGANGDGMAVVSSLRSFDREQQKEYLIPIVIKDSGNPAMSGTSTL
TVVIGDVNDNKMQPGSKDILVYNYMGQAPETEIGRVYVYDLDDWDLPDKKFYWETNEGHP
RFKLNEDTGMLTMKHGTKEGKYHLRFKVYDRKHTQTDIPANVTVTVKEISQDLVLNSGSV
RVSGITDEDFIRVWNYKKQSVDRSMIDKFREKLADLLNVEKDLVDVFSVQLRRKHPPLTD
IRFAAQGSPHFKPVKLNGLVLIHREEIEKDVGINITMVGIDECLYEGQACEQSCTNTLDI
NNLPYTVNANKTALVGVRVDVIAECTCGARNFSKGESCKTSPCYNGGRCVEGRYGLSCVC
PSGYNGPRCQQTSRSFRGSGWAWYPPLDMCDESHLSIEFVTRKPEGLLLYNGPIIAPEPE
EILVSDFISLELERGQPRLLINFGSGTLELRIKSKKTLDDGEWHRIDVFWGTEIVRLVVD
YCKSADISEMEDGSTPEIDLTSCQAEGTIPLFNQFLNLNTPLQLGGLHMENVDPIQLHWQ
YMPIGKGFDGCIRNLIHNSKLYDLAHPGLSKNSVSGCPQTEEICASTESLARCWEHGTCT
GSLAEARCQCHPGWTGPACYTPTVPTTFAKQSYVKYALSFEPDRFSTQIQLRFRTRDEHG
ELFRVSDQHNREYAILEIKDSKLHFRYNLNSLRTEERDIWLSAITVDDGQWHTAKVSRFG
SAATLEMDGGEGRRYNETFTFEGHQWLLVDKQEGIYAGGKAEYTGVRTFEVYADYHNGCL
DDIRLEGKHLPLPPAMNGTQWGQATMARNLERHCASKKPCANVICPDPFECVDLWNEYEC
TCGEGRIQSPDLKGCTDKNECLDSPCLHGGTCINQEPRLRYRCICPPGFWGEHCELVQEG
QTLKLSMGALAAILICLLIILGVDCENEDECLMNPCLNGGICKDYNDSRRYACRCPPSHT
GMHCELELQQSAVVASIDFIVAVIFCVVLLLVLVLVFVVYNRRREAHIKYPGPDDDVREN
IINYDDEGGGEDDMTAFDITPLQIPIGGPLPEMNTKLPFPPLGSEPNVGIFIEDHKRRAD
SDANAPPFDDLRNYAYEGGGSTAGSLSSLASGTDDEQQEFDYLGAWGPRFEKLADIVIVT
LCQYDKLLNRLMNESQFNEAIFYY
Download sequence
Identical sequences E0VY16
vb|PHUM507350-PA|EEB18272.1|predicted XP_002431010.1.24195 121224.XP_002431010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]