SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM551470-PA|EEB19107.1|oxysterol-binding from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM551470-PA|EEB19107.1|oxysterol-binding
Domain Number 1 Region: 557-915
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.44e-118
Family Oxysterol-binding protein 0.00028
Further Details:      
 
Domain Number 2 Region: 60-160
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000007
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM551470-PA|EEB19107.1|oxysterol-binding
Sequence length 923
Comment protein 3, putative|DS235858.1:405849:409911:1|gene:PHUM551470
Sequence
MKSKSKGKPHSDSEGSVDSNSLSLESGNVKTVKDNRSKGRRGSEWEILEGLKDGQRYNIK
PQVLTGYLHKKRKWPLKGWHKRYFVINKGILVYARTPSDITRGKIHGSVDIGLSVISTKS
KSRRIDIDAEEFIYHLKAKRLDTFVKWVEQLRKHRLFRQHLLTFGARENTCTDCDNTISF
QPNPNSFTPPISPARDKTLHCGLIPAATPVGGRLAVWLVDSMPMLEGLQKDLKLIGQNIV
HLSKIADQISSSLAASVTDQENTSEGCSPNVKKDRRKFGLLKKKSNKGSSVDLASSSLND
NLLPSANVPISSQSAALSSSQTCLSSNASSMNSLNRPQSLPGSEHLMQQFVSSLDNKSAI
TPELQMREDFIVLAKDVQTNLKTVLCRLTGECDRLKTACESENSQLLNMNNSNVLVSLRH
SLNQALVQNNELKNRLNRVHEIADLADISSVGPASDAKQIAGNLSYSSSCLSASEFFDAE
DNLPKFEELEDKKENVDNSESSSENNSFSSEEGEEENSLSSENSDVAEDYTMSRISGPTI
SVTGRRTKLPAPRPNLEGLSLWNILCKNIGKDLSQVSMPVSLNEPLNMLQRLCEELEYSE
LLDKASELDDPYERMIYVAAFAVSSYCSSYYRAGSKPFNPFLGETYECVREDKGFKFISE
QVSHHPPISVCHAESKNFIFWQDVRIKTKFWGKSMEFQPAGTANVLLPKSGEQYEWNKVT
TCVHNLFSGQRWVDQYGELKISSSSGITCKLTFVKASYWSSKRHEVHGSITSQDGKVVRN
IFGKWSEGLYCGVAPSAKCIWRPGTMPEDYELYYGFTRFAIELNDLDSETAKYLPPTDTR
FRPDQRLLEEGDLQGAENLKLTLEQSQRERRKKKEAEGKPAYESKWFFREEIGNGEEKWT
FGNKYWEMKKNPGFANMEFEALW
Download sequence
Identical sequences E0W0F1
XP_002431845.1.24195 121224.XP_002431845 vb|PHUM551470-PA|EEB19107.1|oxysterol-binding

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]