SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM569740-PA|EEB19362.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM569740-PA|EEB19362.1|conserved
Domain Number 1 Region: 702-875
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.78e-39
Family Ypt/Rab-GAP domain of gyp1p 0.0063
Further Details:      
 
Domain Number 2 Region: 850-972
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.73e-30
Family Ypt/Rab-GAP domain of gyp1p 0.0036
Further Details:      
 
Domain Number 3 Region: 251-337
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000146
Family Phosphotyrosine-binding domain (PTB) 0.017
Further Details:      
 
Weak hits

Sequence:  vb|PHUM569740-PA|EEB19362.1|conserved
Domain Number - Region: 976-1075
Classification Level Classification E-value
Superfamily Prefoldin 0.0889
Family Prefoldin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM569740-PA|EEB19362.1|conserved
Sequence length 1378
Comment hypothetical protein|DS235866.1:354890:361870:1|gene:PHUM569740
Sequence
MTMKSFPAVVTSDKCYTPDLVKSNSTVMEIFQTFRESMTEQQSNMTKSHSSAATLTSLCP
DISPTNSLFFEVLYVGKMKVSHRKVPETFIDDALVKIQLYEMEKTAKKQCAMTIVANNGK
ICDISSNGENVRDGVGGGGDGLKQTNGCHAERDAINKNYEENLKSETKIIQRANGLRSKE
SNCQNENNKNQDGGGGGDHLLNGQRATALTEISKTNADSHSDDGKNDGVGGGGGGGGYCR
TRAGSLGVIETYRKKVDGGNQNRTMLFYIGKSDLRLISPDRKQVLLNKTLKEINCCIQGI
QNNEHFGIISGENDGYVGYVFKCESNNVANHIVSAISPTIKALKDVKEKTKVPVLSCEHC
PMIWFHKLCTDVEDQNEKKTQLTILKRIETLPEHEQMEIHTKFLGAESSDIKEQNEFLMI
LLRTHCERKQSRHVHDTEETRTEFLNQVLGGNTIFMKAKRSLTSSFDQLLKRKGSHSEVY
QTKVDKRSDSTINEFANHENYHRSYLTVGPSDGEFMKREISKQIVNKKQNFKSFQRDKRG
SSLDEGGNSHPTDITTNKKAEVLHSMPKESDDEMDTSKTPLRNIFLKVNSSPKISPQDNV
IKKETNSTPVGSWRQAIFNRVVTPGKSEEKGVKKTKEEYRELWKTAINQQILLIRMEREN
ARLKASQEEATVKRIKLEYDELGSGLKDAMGIWDMISAKDNRISSKCDSQVLLQAVRQGI
PRAKRGEVWYYLALQYGLKQPPFDSSEFPNYDVSYEDLLKQLTSFQHTILIDLGRTFPKH
PYFSSPLGPGQLALFNLLKAYSLLDPVVGYCQGLCFVAGVLLLHMPEDAAFLLLRHLMFR
RGLRKQYLPDMAALQVQLYQLSRLIHDFFPKLYVHFDKNEVAPTLYAAPWMLTLFASQFP
LGFVARVFDLLLAEQTTDVIFRVIMALLEEHKDSILKLTTLEEIMDYLKVTVPTKMDAGC
VDKIIKKVLVMDISKQLHEFEVEYHVLQEEISTPRAELDRLKKVEMENEKLANQNLAYQD
QLEAISRNVGRLEKLRHAQQDTIKKLETKVKTLETTVEFLGNFITEITEEYKDVEIPGDV
RRIIANLPGSHEEHSKPAAAAAAPNKHPFDKTTFFRKIQSSIDFHEKPHFSEFCAANSLP
NGAKLTDNVNREKGTDGKFKGVPLRVLQDDGKYQNHASSNLTSKITSGVTSFFNSSNGSS
GSNAAGKNFLKNNKNVSVSTEASAEGNSNGRQHNFSSDIGSLNIKKSIIGSSHKNERLCK
SGREHASSTDKPLPIISNGTSGANEQKENHNNDNGEESENNHLHPLDSANDVIITFNGTT
KLKSLKSGPPPLFRNNTLGFLPYSNNNNNNNNNNNNNNNNNNNNKNSQPLHISEDFDS
Download sequence
Identical sequences E0W156
vb|PHUM569740-PA|EEB19362.1|conserved 121224.XP_002432100 XP_002432100.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]