SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM580720-PA|EEB19583.1|Prostaglandin from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM580720-PA|EEB19583.1|Prostaglandin
Domain Number 1 Region: 232-383
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.13e-50
Family Glutathione S-transferase (GST), C-terminal domain 0.0000125
Further Details:      
 
Domain Number 2 Region: 109-184
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.51e-19
Family Glutathione S-transferase (GST), N-terminal domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM580720-PA|EEB19583.1|Prostaglandin
Sequence length 412
Comment E synthase 2, putative|DS235873.1:370636:372330:1|gene:PHUM580720
Sequence
MTMFNLRVLSKNFSKITVNKNIRLYSAYEKFNAYFGHKSFQKNPVKLLVAAVPVTALGAG
YYFYGTKKENDELLNEYDIRNVEYQLLESKPNVPIARTVNKSKDDLNLNLTLFQYPTCPF
CCKVRAFLDYYGIPYEVVEVNPVFRQQTSWTTYKKVPILLAKVKDGYQQLNDSSMIVSAL
KTYLFNQNISLEEIVNYYPMIEFKEKEGKVKSDVLNKYFLMFQDNVPKDKTTEVVKEEKK
WREWADNELVHTLSPNVYRTTEEALQAFKWFSEVGEWDKLFSAWERFVIVYVGAFAMWLI
SKNLKKRHNLKDDVRESLYDSCKKWMKILSMKNTQFLGGSTPNLGDLAVYGVLSSIEGCI
AFNDLINNTNIGKWYYPVKEAVNNHKDVNKTKQTFSRSNFCYGQDFKKKTIA
Download sequence
Identical sequences E0W1Y9
XP_002432321.1.24195 121224.XP_002432321 vb|PHUM580720-PA|EEB19583.1|Prostaglandin

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]