SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM606460-PA|EEB20222.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM606460-PA|EEB20222.1|conserved
Domain Number 1 Region: 616-759
Classification Level Classification E-value
Superfamily PH domain-like 4.46e-28
Family Pleckstrin-homology domain (PH domain) 0.0051
Further Details:      
 
Domain Number 2 Region: 1270-1395
Classification Level Classification E-value
Superfamily Second domain of FERM 5.89e-20
Family Second domain of FERM 0.0049
Further Details:      
 
Domain Number 3 Region: 769-879
Classification Level Classification E-value
Superfamily PH domain-like 9.18e-18
Family Pleckstrin-homology domain (PH domain) 0.0065
Further Details:      
 
Domain Number 4 Region: 152-224
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000653
Family Linker histone H1/H5 0.02
Further Details:      
 
Weak hits

Sequence:  vb|PHUM606460-PA|EEB20222.1|conserved
Domain Number - Region: 1171-1248
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000537
Family Ubiquitin-related 0.069
Further Details:      
 
Domain Number - Region: 1396-1484
Classification Level Classification E-value
Superfamily PH domain-like 0.000615
Family Third domain of FERM 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM606460-PA|EEB20222.1|conserved
Sequence length 1525
Comment hypothetical protein|DS235882.1:2272691:2281831:-1|gene:PHUM606460
Sequence
MERRGDWSINSETTSNQSAEIPETQKVITKLETQVEEQKKLRLQEAKQVEAKAALIKEWV
ANKLRGLEEQNQQLREQNDRCNQQIELLRNHLEQLRHMKPGVRTSLSLDVDKEELTSLNN
ICNSKLWDKVLTVLISLAENEEFEQNDRRPKGGARTLDFIQSAIFNLREKNGSCVENILD
YLCTRYDVNVESVMTRVMTALRRGVAIKVLEKEGNRYRLSKAMSFQELEDDKRKKGVGVE
SQIKFAMGPHLTDSMISNEFKNDDDVIMDAEMVDLEEYSNTKRRSDISRNSVEEPLYAEL
KKTENTEVMTSRLSEDLEEAIVNLNIIPDISMDGDVSGDDLTHDYAEIYTPSKERMPWKE
VNCSVRSIESDDLPPKPPTPPLHRFPSWESRIYQIAAAGFNVASNHPLLSTAHHMNMTNS
LPYDKTSHGTNMSPLHNSLPHNLAFKACHSPNLHHKINSSHQNNCSVNEIHSSECSNNNV
IGASLVTTGDKSGGGGGGGTGPGTMGYCDINVPVYATVKGCRGSDIVRHSIFFFQRASQI
RSIPFTGDSSDDSSDGEDCPNHSHASQGQPATRATSSSEDTSLSGGSNSSPLKTCSLLPS
KTRGLYFLLKKKKDTSFESGTSDDYAIPPDAVSSTSASFESSIPSILVRSSYMDSPTKTK
GIESLEKAGYLTKLGGKLKTWRKRWFVLKNGVLIYWKSQNDVNQNKKPAGEIFLDESCRI
TRAEGAATFEINNGRKTYYLTADSIAHMEEWLRILQNVQRRNATKLLLNKEEQKPTLQGW
LVKVKNGHPRKCWCVLLGKMFLYFKSSSETNPVGQINMRDARVEEVDHVSDSDSEDRDGE
SNEYTIAIFPSHYGPTYLIFSNKLEKDSWLYHLTVVSGGGPNAGTQWEQLIQKLMETDGD
PNNVLWRHPMLLYSKDCITSPLTTLSTETLQSEAIKLFKSCQLFMSAALDQAGIDYHVVL
AQNALQLCLDQPELQSELISCLIKQTSRPIQQKQGVQVKGTIKLKTPRPSSRRCYYLLSI
PVDTRSEKPPTTSVGHQLLQQYLLCATQSLFSCDSTNRDSSSSASSQTKGSPTSVQATCG
DFSKGCPSIQVLTQGWQLLALACSLFLLKNNKLLWFLKLHLSRNADTKTECGKYARYCAR
ALGRTLQNGGRQVKPSRMEVLSILLKNPYDHSLPHAIPVHMLNDTYQVVSFDGSTTIEEF
LSTLAQEIGCRESSANGFTLFSDDPIEKNLEHFIPLDAKLCDVISKWETALREKGSGKFE
NSRLIQLVYKNRLYFKCSTRTETEKERLLLCYQTNQQIVLGRFPLTKELALELSALMTQI
EYGEYSIERSQGRSGNLLHQAVNDFYPYRYRDGLSPQKMKELQDELMDKWKALKGRTIPD
CVRIYLTCVRKWPFFGSSLFQAKLKTGDENQIGVLWVAVGEDAVTLLDLETMSPLVRHPY
SEVVTFGGCQDDLMLVVNPHQKHLFSLSKPKILQLTLLIADYMNALGRLPGTPQMGSLSR
RSFRRPGQQPDILKSTPDQQHGTSS
Download sequence
Identical sequences E0W3L6
vb|PHUM606460-PA|EEB20222.1|conserved XP_002432960.1.24195 121224.XP_002432960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]