SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|100939 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|100939
Domain Number - Region: 70-184
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00102
Family APC10-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|100939
Sequence length 189
Sequence
MNESISRYDADKTGMADYALESAGGSIIGTRCSKTYKKGMSQVSVFGIPLWYATNSPRTV
IQPGNLPGQCWPFSGSVGYLVVQLATRIHVTTVSIEHVSKIITTFGGIESAPKEFAVVGL
SDSQDVEGTILGNFTYNKDGLPLQYFDIPVEHHSSSYLFVELRVYSNHGNDNYTCLYRFR
VHGKPDLKS
Download sequence
Identical sequences T1ED22
XP_009021135.1.102002 jgi|Helro1|100939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]